` ,J ``8  p@@p .text@@  .initII .dataP @.rdataPP P.lit8*0*0` 0.lit4,, .sdata,,B`  `.sbssoo `.bssqqrsrc.comment$ ``<'' $t0!'识! y믄p 7 7 !pt = 7p@ ! ' !'XX$$,PT\( L\T<<$ 9$,䏩\((%H$ 70%@%DD@lD\H 0%\ 8P\$ @%HD쯰$ TL,L('P'䯿<x|8tp0%  %l$(% 70%@%$hP$ |<<&$ 9$)$$ th`htphl$$'`'\'X'T'P,($ 8% Я|P 90%P >%<8'x'ttp$! $  %t<&' $$ 8X'0'0 ?0%$'p'䯤$ $x! |<<$\ 9$@u$x MK plp!qx!x|x'l'h't 'p@% <%$h 98%P$hd%j@Cddl px!| z'X@*\  %% 8x@%X $@! dl `lh!'8 8X''8 :A0%\ >X > %dlȀ@! id%*Adl` >` %%$ ''䯦P$HLT P$ DTL<<&$ 9$'$T(% 70%@%@@ TLEG<'$ 9$D@ '<@%L< 90%< >%$ 'H',HL( ;$<%DL$(% 'H< $į䏘 L<&$t 8' 7p$<  9$< %)䏧L'H ௠@% L<Fg$t 8' 7p$<<@$$8% <ï<<@$$8% <ï<<@$$8% <ï<<@$$8% <ï<@$  (%<<$;d$0 ?8%@% L<$t 8' 7p$  yH) L'Џ<$0% ?8%@% L<'$t 8' 7p$ 7p %,$('H%'0`䯿l2hd\XTPLHЯԯ܏ $$ %*܏`l!$$$T$B$$% 8P %@%<&_6-o)(% 8 0%@% $A1@!  2/%2@ @ %<$_0%' 9]$% &%) @2 <$`0%' 9E$!4$BF$-  @<(!(PIJ I`"Џ' 70%M G<'9`4<'$` 9'$%*%l%ɯЏH %l%*%Џ "Y "%K% %O ܏Џ'$ 8H #CK`G< %`l<<'$`\$`@ 9$%'% fBD EF@ @^%l%%SBD ЎF@ AI|$Џ 0%v$ԎE F $P;dЏԎE & $P%K%%&+ <$`x'0% 9M$ԌEF $P'(%*%l< 8X$`6$0%@(%!Ȁ08# ! !H$$B$$chI$iJ$BjK$kL$cl`% <$`'0% 9$lHLPTX\`dh''PLH<40%%TPD@8$$$<&R_OD 8P* @%X&R'(⯨<$a  % 90%2i<<&a&s`l$'@<&R_Bfl K`F %' 98%UBF %' 9'D 8P#$p*  %`(% 90%& %(# 90%&*E % 90%B*$L  % 8X'<$a( %0% 98%&BM  % 8X'<$a< %0% 98%BN <$aP %' 9 B$A$A$AB&RlT <$ad % 90%'(T048<@DHLP''0,PTX\$ d0 "'<$ "$c( "'쯂,TP\ P(P  DP\ 'D@@ %!%DT J|L<AX%5K|MT@(% %PX0% "LL@ %  %% % CLL,'P'8%<40pxN 9'@@%p<%c% 8P@ %`B !<$ߠ@! $1*@%@ % k$c`!1ro$. xr#$d(% 9$ ` ^ @ %@ @8%p<$c@0%' 9t%$ :TT@%G &$ :Y @ %@(% ; 0%TH! $$(,8<DdЮԮخܮT : T$$d!CX!l$)  p!!$BA$c $ D0% @(% 8 0%@1@!   `lL* `p<$c 8X@0%%`x%<048'p'Я8%0$̯4 :8048@ %GEN O X(e!H!*(J lh!$N<@@@@ @$@(@,@0%a< A4$ H8%JbA< %Mxx'L > 9'X@@ %< 8X$k$ 8P :$D<|$k 8X@ %| $<| ;xxL''X( %,` %<f<$n\ 9$n@W$e\d V'T@dT d\<$n 9'B$ :$ `\$@0%aY@L'LH$add$ 8PP :$DP@ %dE ;P d$dP 8$PT<@ $o`$a \L\ F %L\ :%,'X'Я%  @@  ;@$N ; %'0'($%X%@% P%) <F<$n$n 9` %Z$E$.` %`0%HL  LDHLD@@H%H$F( $ %H8L "DH8LD@0%$ $C @%b@ $+/$G< "` %+$$+A$xX $%9$G%< ` %@%$$,$G<D }` %D@ :` % %b-$` %< %$'@'$L$0%@$N<$(<0`@' "HH@%D$L$<'< $$'H'0,($(%%%%4  &q% %  L0%@@ %$p Ӏ!&10%4 $(,0'H'(,XH%@% %<f<$n$n 9 %$d\`d 8PWW`\$c@0%d<\` 8$o`\@$$ dd<<&$o0$o 9 %$dXE\`  L %`\@@%t$$dKMl px!`$dd%<'oT_8'\9dD \ 8PHdHd \$c!@0%'H@ 8\H@\@dblxx!y!$$< %Jo`*6$k`mp!.d$m <$oH 8\H\@ dyk* hM`!d<< $o$o 9 % %d<<$o$o 9 %$%,'X'$<pt %t<f<$p 9$o$d| 8Phh$v'@0%|<d 8$p4d@( h|<@%$x菤t'`P G$a` F %` |tP'`E I3$a^th$v,h|<d 8$p@d@"( !h|tp  L@@ %H$<@$yP<'`  |X` F %`XP<  '`0th$w!||'$ 8@||tp  L@@ %$<@$y<  |'`` F %`  t|t<<F$p\ 9$pL$t :%<'p $%$$$'($$%%,D$$$D 8P<$p 8@0%@ D<<$p 9$p $ $D<<$pد 9$p$ F %@ F %@$ @(% F %@D :%,$('@'دPL(%%T( @%<<$q$p 9 %$0 8P0$aa 0 8x'0@$ <<$q0$q 9 %$( P$' 8X@0%%$aa;$c< $q<0 80@0$c ) *$ <<$qd$qH 9 %$ % V'@($( <$qt 8x@ %@ <$q % 9'$î/$ca&$c 0 8'ȃ0@$c + $c'Ў(  L %@g$$)$ ' 8X*0$ca;$c< $q0 80@0$c )a *$<;$Bq(  L %@?$'ܯC`w$$e( 8'௢ %@0% 98% ;c `$`$ca $c 0 8'䃣0@$c ) $'(  L %@$O0?/$ca7$d< $q0 80@,$d + &$ <<$qܯ$q 9 %$( % '@(  % '@$( R@ Y(9$da$e 0 8'0@$'(  L %@$$F 8X'$ea$f 0 8'0@$'(  L %@'ή)'ˮ+$faG$g 0 8' 0@=$g ) 7$ <<$r$q 9 %p$(  L %@h$  % I'@_$ǥ荸Ȁ8!!J ID0ǤF2!D$F("F'(F2PDD 8X$ga&$h< $r,0 80@$<'$Br8(  L %@+$$l4f  % 8x'l@$j(5Kk($A  % 8x't@$l(5m($A  % 8x'|@$pn(5{o($p!/ % 8x'@,$p&* <<${${ %0% 9|| %5P!F(% &g@|ka&|<h!<${P${@ 9 %|&J&$p! % 8x'@&* | %!&(% &g@ޏ|i ڏ|&.&>*A  %' 8@0%@&K* <<${${x % 98%X|| %h! x&f@O&&<%{<<${${ %0% 9A|&* !&b|x<A& 3` %@cy ys IiS %(% ü`0%| ;$B%K@b$@$ Lb(0M4N<An($ `(%%| ;$T048<@DHLP'',($ %`),b BNn <&1|(@% S %BO@%b(0X4Y<Ay($ `(%b$@$H@, $('@'Я ;'0'Я$A,0% (0O 4X(<A$௦0 (%0 #D@hg@cI(1*@^ K(<A5lL( $T$A0$ % 300 `b``@@%<~<0 $~ @=@ %0(1<A$(% 00<A$ Ġ %#$A$  (0H4I<A($ (%$A     '0'X<8 <$~ @$<$ @$$+ <<&$| 9$|$ 8P$.%  L@@ %s$ 5@(%$ 6y$i<E  L@^$$c&$f<d 8$|@$f) <<$} 9$}C$ 5@(%$ 6y$ 8<$f:$i 8'@3$i$ <<$}p 9$}T$<9D< $@@%%p 6, % @=<A$|<  8%(% ü0%   ; %%$i$s 8'@$s$! <<F$} 9$}$< kD<` $@%P 41 <F!D0D8$} 8X'\ '\ 8X''\ 90%41 <FBDPDX$} 8X'\'\ 8X''\ 90%40X0Y$<FDD$} 8X'\'\ 90%40H 0Y <$} 8X'\'\ 90%40H 0I(<F!D0D8$} 8X'\'\ 90% ,0I < $} 8X'\'\ 90%, <$~@0% 98%0$A $<$~ 90% $A<$~( 90%@K CKcF%f(' 98%?%$s1 8'@*$ <<$~X 9$~<&$< < $~@C p%( :A0% %<<&$~ 9$~l$%<8''H<H$H<$ '<<@%#$8 :DDH@D$@@@ @@@ X,@0@4<AD@@@(@$$|<@8%  |b H<A@ ü$$Y @$@'H'ȯ$ %`$bBNn<&1~@% S %BO@%@$ '8'@<@<$~ '44@@%$ :<<@@@X D<A$唯8<  |@8%8C '@`%'pLHD@<840,%%1% %<(<$$~ 9 %$'x$r* <f<$<$, 9 %$d 8Pd$a@%A ' 80%@ $be % x&&,@n$o$bA>$hd<$X 80%@7$hd 8P$iA @%d' 80%@* $ P)0$iA $od' 80%@* $oC 0$oA d' 80%@$ 8*0<f<$x$d 9 %$ 0$hA"$id' 80%@$if-4$p$.4% % &' @$84$$947* *4$iA5d' 80%@/e&  L %@@%$ (@%dl1((<<$$ % 9$㯯c 6, % 6S %"X8ӬQUd<$ 80%@* e % V0%@$ï)4ǥxǤ|5* $F !*4A`$&(,4Ud<$ 80%@* e % V0%@$ .4ǩxǨ|5$F B/4$*$94Ud' 80%@* e % V0%@$ DZxǰ|*4F 5K2}+4U$wd' 80%@* $we % V0%@$ nǥxǤ|-4F !5&c.4$wA"$xd' 80%@$xf84$$O94% % &'@$ J*4$AX$+45m@-4$xA$yd' 80%@$y%f % &' @$1/4$$)84$yAd' 80%@%f % &'@$)4$!P$*4f< < %X%k$<<$$د 9 %$ &q&s% . 6S"O@(%/Q0X4Y<A $4L,048<@DH''D@<804(, $$x$% DǗ8ǖ<Ǖ(ǔ,K"0hpL$ |"YT|IX |$A <d$h 8X@0%$ U   ?OH<A $ld %<@  |8%$% ¨$d F %$d %<@  8%|$ ! <d$ 8X 0%$  t > 8%h  @0%h ; > L$ALm$ % ?`(%LDH'' %$LP 8P %F8!* p@* %$` % :@8 <\@ % ;8@P@ ;& !@%$ 'H'LHD@<840,(%$%<&RߠBx!3 $c&@Bx!%<&Rߠ : ஠@%'h'$'tB@!0c` &BH!#0c`@,L@ 8%` &@BP!K1l#*!e  %$d %(% ; 0%p! P(%b %(% 70%b&s%ŮL(,048<@DH''40#%D@<($%8, d%%'X : %*  7@%$ $ d @% 8P@ %$C$ #!R* @R* $R :@ %@%@ % ;`(% ;` %% qx!$ &1q! % ;(% % 8X'\ 8P %&* "! &D`%, $(048<@'X'PX%\TPLHD %$$ $$$P $   `$o8G$d@D+ @=` D) $ 'X$ hdX6\$ d % <5Ά$'L'H'h'@'d,($  8%@d@ dH$ dL hd`` % >dhBhh : hlp v%%%'dl2!JE$ h!8 ' % 0% B$@&d!T  (% 0% $AdR`!C(A < S$Џh!$pl'p$ *H$ p! %$ $ % $$  %(%0% >A'@%88% Th ; %h&+&R &sp  <@'`<A$ x0% $菩tx|$L@$'``dhd$ x@$ Td'0% `8%P p `*/lt F %p`t $$ $P 0%P $% $% $b$m$@@%l ;\d > \'0% `8%P \DHLPTX''D@%%xD$!Dxed <5$ 't'p'h'd'x,($  8%@hDt@dDd h<$ 90%$Sh $M$AptIT pJX pp$a(% 90% <p 8X$$ - x @&x#p$ x(% 90%<p 8X$T$xht >`  @0%@`` ;x > D@''௿,$`%$ ŏ,$ /&X89 M@-%%#n/ @!Y$Bb ` `- p!/%8yY- $p!%'hd   Do'h $D  (A$  @%<d$D S D  d$ A%d!h(a ` d9 (h!.%/9 $(h! d. !O!Xe$'h $&  'h >A'd  @@%$   `$$ $ \  g`d T\ `'h, ; % ,ko$BE+ \$c)$ @,' '(<8ܯ௧䌃%$c(ad '`\ :` %\䏤\<$& 8Xx̌hЌd 8P :$DЎ @ %% ;< I%J̎`\ @@$ d 8P@0%* 0% <\ďďx!$b@<I'd ;ďd@ ď '`h I\l` % ;ď<8'%'Я$%o %+ x d<$0 90%0$ h<A$ $`0% 00b'0'Я0%%)  <A$ x$ 00'0'<840,($ %NP%%* e$F@ % 8X'``$ % 8P[ % ü0%'8',($%0NH$Ax$Ў9,&$ 'T@$% j'TT > D % $% Ġ$% ` %5  RC Tn %$% ž @ &$ 'T@$% z'TT > `",  %5 OӮ Ў$x$Ў%$  %P$L QH D1*@,PLH Q %,$('h',($ @@T,tRBt<&1@% S %BO@%B0X 0H @E $ ƯB0H @E0$ ƯP <I&1  % (% ĠJPD ;D ;K1l<A@ $?L ;@ %@ȏ, $('@'ȯ%1y0  884h,@0%Hi0Ied r4 >'8'D@(%%LH<` %<&<$$ 9@ %7$$h 8PSSh$t-L$Lh 8'|h@&(aL+ $b $d <&<$@$ 9@ %$b x 'H'I%%@ % V'xL(a %`h  L@ %h@@%$J1K` <f(<$`$T 9@ %$SP$awS$Lh 8'h@n$d$a&< %<<$爜$| 9@ %$dD1 hD`dl<$ 8X%% @ % D$!P$: D@ % V'D@%@ % V'@@ %@ % V'<@%@ % V'8@D$D` @<8<%O|$D D`@5Kd<h8 D l 5^ ЃS$ccS$Lh 8'h@[SL) U$d $a <&<$$ 9@ %M$dDD%%  ;Ю3(<$4 P` %de ¨@0%*% ;% 8P % :$D̎% ;@ % 1*@' 0%& $@de z 0% >%S$cabS$Lh 8'h@ZSL) T$d $a <&<$h$H 9@ %$d 8< I%BM%% @ % ; %Ю1<$ P` %de ¨@0%%@ %' 6'@$ ; % Юď1*@Ȏde žS$da!S$<L$ 8hh@$d <&<$牼$ 9@ %$ $1%  y` %xS$fOS$<L$ 8hh@E$d $a <&<$$ 9@ %e$d 'X'YY%$ 8PSS$a! L$ L 8'@SS$pA $ L 8'@$ <& <$4$$ 9@ %2$ RC` %'S$gavS$<L$T 8hh@lL) g$d$a <&<$犀$` 9@ % $dH0M$+$-$+0N$+$-$+D1&y$<%0O6$<%HH.$A<'9`Y&$` % M/ 5* ЃS$gJS$Lh 8'̏h@BSL) <$d $a <&<$狘$x 9@ %$d 1n@8X%% `$$8`  L@ %@@ %$  5L@  4( 8 RC` %S$iaOS$<L$ 8hh@FSL) @$d $a <&<$௠$ 9@ %$d 3d oB%%   d Ư$!H$  " %`@ % Ŝ@0%@$  5L  RC` %zS$i=S$Lh 8'ԏh@5SL)a /$d <&<$ $ 9@ %e$n <f(<$D$4 9@ %Y$Ю3R%def @<%hHG$` % Q(%;S$i!OS$<L$ 8hh@FSL)! @$d $a <&<$į$ 9@ %#$d 1L d0 oB%%  0d Ư $ap$ " %`@ % Ŝ@0%@$07  RC` %S$i7S$<L$ 8hh@.SL+! ((a <&<$ $ 9@ %$$d  `C'ܮI%$ " Ю 1Lde ĠS$iNS$<L$( 8hh@ESL)a ?$d $a <&<$X$8 9@ %$d 1D(, 8X'%% @ %$$@ % V'@%@ % V'@s$  (5  , RC` %aS$iaKS$<L$t 8hh@BSL) <$d $a <&<$獠$ 9@ %I$d 3<H=%%  ` $!P$ <`  L@ %@@ %*$  5  $(< RC` %S$mNS$Lh 8'菣h@FSL) @$d $a <&<$௠$ 9@ %$d D1  DPT 8X'%%  @ % D$A`$ D@ % V'@%@ % V'@$܎D P5 D T5ЃS$m!NS$Lh 8'h@FSL)! @$d $a <&<$ $ 9@ %$d D1LDHL 8X'%% @ % D$ap$D@ % V'@%@ % V'@$ԎDH5DL 5*n ЃS$o9S$<L$@ 8hh@/$d $a <&<$t$T 9@ %a$d m'K' NU%% @ % V'@M$$` %$  '9S$pkS$<L$ 8hh@bSL+! \$d $a <&<$ȯ$ 9@ %!$dD0I 'J0L'M%% @ D$ap$0DS 8P %S$uL$ L 8' @ SD$@$D5  DS$pA$ L 8'(@ D$h$ D5 D<& <$$ 9@ %$7ƮЃS$pS$<L$ 8hh@xSL+! r(a (a <&<$H$( 9@ %$$d`e ` %@ %@(% :A0%c`%% h P` %h$a@%` iI$j J%c`% %`lLm k<I$ Ġ` %$` %c`$ 8P@ @% :$d S$D NR% ;3M Tn %IS$sfS$<L$l 8hh@\$d $a <&<$珘$x 9@ %6$dD0Y '0I0J@'8L'%% @ D$X$0 DS 8P %S$uL$ L 8'@@ SD$x$D5DS$p!$ L 8'H@ D$A`$ D5 D<& <$̯$ 9@ %$5ۮЃS$t@S$Lh 8'Ph@8SL) 2(a <&<$$ 9@ %$$d `Cb,B%$ "Ю3) 'p 0%& $@de j 0%p >S$tANS$<L$$ 8hh@ESL) ?$d $a <&<$P$0 9@ %$d  @K|%% `@`  L@ %@@ %l$  ll(@1 Vde `OS$w!,$<L$l 8hh@#$d <&<$琘$x 9@ %>$ Ю1L7%def <@< %M,$` % Q(% &< <<<<%%'%Α`%k0<<$$௫ $ 9@ %$3) <A$?L `(% 5L %L<@DH'`'ȯ@%1%cx3 bIp JtKXHM\ ND1@9/7@ !DD0 $DDE|ELЬHpFtGXH54@1KDM J\<A$?L`(% 00X7YЏ'8'$< P%.@%$X@Sy3+ `NxE($<$ @D< =L 0%D<@ mD1+OyX/#lp  $!< Xh!m|p%`|$Xl\#,mt $<! Xp!nx%`i|$x y $l xE( $<$@@D< =LD< =L$|D<@ I<$N@(OD,@LXHy @ %<D O@<D@@ L4 M8( x@o!x ($ h@-p!nK4obo#0Lxymk-p!nx#bЬoX8l0M #yknxnx!`#lx $m<E4F8g$ =L$'@'`LHD@Ȁ8!@!<%$ P $ $ !'''|'x',($ @0% 8%@$!<$ P %$$!'''|'x',($ @0% 8%@$!$  |$ 2x <<|$ =L$ >x<(&$$ =L@8% S %JJ  D < h@mp!.D@@@!( I 4J = 8$$ $p+%''t' '@p Ү  >pH(H! I)P!Lpۮ+p  O %@L L@DH''x@D<%Ȍ$$ $X%$'p'l'` \8%$'d''|'x't '` 'hX \\p!%px8Dx!#xl+D P!K`# xx@!x|H@)P! h $lp!.4d!88D<@''Я$N0%5@OЌa$3  % 00x2<( =L$X.$a$ M{ %'$a$5*x`<( =L$x$a$$h$x <( =L$$a NF %'0'ȯ8N51 O<A$?L 00H5 IЏ'8'4$nЌb|x$$@%AoЍ xD3 mpoXMp#ntmx# 8H!y\P!j@H% $ @$ f0 xoy<8p!h#xx##8`!nm<`!0 yxm8p#@Mx!#oh#X!yn.X!"@X 0bD0M0O04y 0%0 %hp\X` Pdhp\X`d `%T4 8n x8mMG4ijx yn<$d`X\ph 8%(! =Ln0!h<xefg$ =Lhp\X`dmoph % 8%(!  o0!hpf0 4nTPxHp % QRLpPLH Q4'p'ȯ$x$Я8 Я448@@0%D3 1pX Pj`#L<@<t\8 #D@@@ %HXC<+Pj`!L\Lx!YXPHiX!K\TLhp!N HOLYPXT@<@@H XI$\K(`J,dL0hM4lN8xODDYD0x0h0|aIC5+0CD DKC0j@4l@@L%0m !@! 4h %+K pLp!q!/H%X  Ȟ00 >'8'@<840,($ %%%'\<$$DE0% Ȩ 8% %5  Ў$Џ\`7P#@$`x`<$ =L(%< $(,048''P40,($ %%'L<$.183 $%`0% Ȩ@8%@ %5   Ў TX$ Џx< =L$4 $(,0''LHD@<840,(0%%%d%0 #@# ! ʐ!d` h#x#!!x 8<4$@(% 0% =L4B8*.L r`!h# 8x!#x< =L$䎉 3` %J(!+0!  t&sx  % <$M(! =L.0! % QR`(%&$L(,048<@DH''Я%N1de $F'0'4ptx$=x%8%%|< ` h h!ߡ 1& %'T$ lX 9dT`lXd$xapT< $`!ߡ1V %'T$ lX 9dTlXd@X%`2$!H$$-a$+5)$+a?$'T$ lX 7\ThlX\$-a$+5)$+a+$'T$ lX 7\TlX\@P%D0Y 4L D5)` |h18  <Ax$?L ll5 %p<t$<'p 9$4'p%%8%DDN4X8Hx!x!1 8! $!BDD'H,LHD@<840(%!%!%%''' 8% \0%@< S$Xt`%bb @ lmb$c$N$@%%f%% %'%'x'x4y8xq# M#"0HD0I B*4$D,8##b* :(#* 7+<dh!m* 1/@p!* +@x' %x%tde't0% 8%@< S$t$xb I"t %t& + $c1  x > %@`%@%%`%L(,048<@DH''D@<Ќ$x$%Ю)9 P(IP! Q X!l /-!!)/ $$$ $X$&& & 'h'd '` &x\ < =L$<\ =L$X \DD<@'p',LPT%1BX3 D1 @  SDDLjPTX8,'H'$DH1 8%<$8 S@8@DhЌbDxH$H$0Ji@yl4K5kDmЌb0N0O<A$?L(% 88x7y O %$'@'40,%$$B : $<@% P$T%& C%$<$h PL#Ldex#$ @0% T$ ; %4,0'`'$ H@9$P)Ho  % < @& <@<$x ?<<H  ?@(%< ?$  c %$H<$ P<<b$H $ 'H'(40hP%H% %<f<$L$0 9 %~$f$bA $cA $lA$rA  $ @% $ $$$< 8X$db$fdXl %@(% L8%X@@%U$$P :XPXD$ Od@@@H X,<0@$@(@,K0@4@8@<@@@D@H@L@P@p@t@@@@@@(!Y @%  9H<<A$n4  |8% d<A($V <8%H<p!Δhld(%$ X$@ $d(%840'`'0(%4@%H%% X<f 8X$$ %ld hld 8PSSldh$a'Td<T$įhd 8lldh@S )! <f 8X$( *J$(  S$cESd<T$hd 8lldh@7$!$ < px!<$Ɣ %8% έ!X$!x < PjX!k<$Ɣ %8% έX < hp!Δ %5(%%& X$gX c %XZ4S$d-Sd<T$hd 8lldh@ ST+! S @)! <f 8X$3( l,$  S$d8Sd<T$@hd 8lldh@+ST) &S (A )! $<f 8X$L$A % D$3  %'h D$S$fAGSdThdl 8'lldh@;S `6)! <f 8X$x( qH, $ , $ K($  Yz % h $2H$$BAݯHJS$i$SdThdl 8'tldh@S )! <f 8X$( ( \o %$XS$s#SdThdl 8'|ldh@S +! )! <f 8X$` % D$S$tA2dThdl 8'ldh@&T)a ! $)! <f 8X$7 1 % D$ % D$ <8!P<f 8X$*1K` 1<A$e (%5 c %% c %$40'`'ȯ$ %` ;` % <A$s䯰 I3$a ; Ư$ ȴ( ȴ4 s8 g@ g< gD ՄH ՄL ƯP Մp gt Մ <A$r I3$a ; ; ; x ; ; %$ '8' LH௦诧쌣%`<A$s`(%$a I3<A$r$a I3쏯<$Ɣ̯ ˴@F$$ (  4$  ,(& <<$L$8 9,$# 4l 8$ ȱOȯ<4@ L'D@% Մ<D4( <*( ȱK$@  L'H@% ՄH 4$ ȱN@`o$@ L $ "' Ŝ@0%@L$$ L$  L'P@% Մ dPAd hah ) ^p< A%r@ hN$ L'@%%t Մt , 8P :$D%, ;@ % $, 8P :$D E, ;@ % C8$ $a`$@ %@  8x@ 5  $' D$h G$a)`%<A'9s䏤௹d`(% C8$@l D$ ;l 8P :$Dl ;@ %d G$a [ % 1*@% 1l<A$e (% 5%LH''`D@$x$%@X3 D ( @$ P $( H$ DLEF$(%&f lܯ7l$w!%d'` 80%@$A < %ď< $ 9 $'e@0% i %@@% j(% jg@ %@@%%f<%ή<<<$$ 9$%lǵ0Ǵ4Ƿ8Ƕ<ǹ@ǸDLPTX\`dh''`4%0%<8,($  %%% pZ'@ % pZ'@  % pZ'@  % pZ'@t$ǣǢǭǬF,<EǣǢǭǬF,<Eǁ@ǀDǥǤǫF !ǪDNǤ58!DǥF 2$ DD@F TǪDOǫ58!DF DDF !DX78!DF 2$DD@F TDY7!8!DF DD(%$*  ,I*  (U*  0k*  %((% 'Q*  %(% j0%%< $(,048''0,%'P4($ %%% i0%@+@%SXXXO XX8HX  @%Bj0e$f(g,`% % it H %5l jg H@@% 4` M nNqo44 $(,0'h'$ % %$A$A,$4$N- p<.!. $ $$$$% %(% o4880 %&08 n-(%80H& 0$A$A $ @ %(% n-* $A % 0 %(% n-+ % o4(% c %$ '@'$ %1H%&89T$A$A'$ *+, -$ . /8 9$*Č(+Ȍ, Ю-Ԯ,̌8 ܮ.،0 /T`%$`% ' -$n./P!D F!40+9+`!D@FB<8 !0 F 4DX78!DF DDF QDM58!DF "$DD@F 4DN58!DF DDF QDO58!DF "$D@D/ $* &,"* ! ( *  0* PLHDT  % $(% '0'&PF 0<LHDTEH%""K$@1T'@%X%%`% a%k aa$  % o4T8T$\!m Px!y% $BA$c\ ) % j (%T'Xx%%`% % $X o4 %$ 'X'$H%@P%B%$A$A%|6$$(   'T DL` :dDL`d@@%$D !$c!$BAyX` h!&$P @(%P'T$ ; %$'`'ȯ$H%0N'$dt"0O $A$xH<B$8 `0%8 bx4YyH<B$8 `0%8bxb|@ $H0E$F(G,` % it$'8'ȯ$<%x ܯ8<8oHdt5 xH<B$`0% 88bxyH$!@$hH`xb|@ $I0E$F(G,` % it$'8',T%LX@%HPH%@Dd<B$XTP :A`0%PTXy\X0E$F(G,XTP` % itPTXy\hPh\i`b`"* $JbTiX$JiTjXLlTl HnXD ,0$(,` % it,'P'ȯ$P@%H%`P%$n @@`(%$`(%0% 8%@ $'8'ȯ$P@ N0E$F(G,8 it8P$'8'Я4%8%0%e8 I008@ $g@fD%F&"'0DDF.<E.F `F `<EF aF.!lj(Lj,F(2DN58!DF T$DD#DF!F. F.alj(Lj,F(2DY7!8!DF T$DDDF!F. 'د$ H$x$%wH  %P#B@ $A<A @#H%)A C$A CX!b@ $A<a @ A C$A C`#@ $A< @@# <x!#$c`d!@ $A< h##"@ $A<! #h#$G$<$d'L 0% 8X'L ?8%@  : @w  e`#@ $A< @#H%)A C$A Ch!@ $A< @A C$A Cp#@ $A< @@#@!%#$c`dP!B@ $A<A h#X#b@ $A<a #h#$G$<$'L 0% 8X'L ?8%@  :$ '('ȯ$@@%H%?P%; 8 # LT (%_$da;Ï䏦ȍ 8'8@4Ï) /Ï$ 䏸䏤<<$ 9$g䏤܏&(% j'@_4 hmx!( $  %"$ea4Ï) /Ï'@ 80%@(Ï$A 䏸䏤<<$8 9$*䏤܍(% j'@" hmP!X, %  $epÏ+! j<d$H 8 0%@cÏ) 䏪䏤<<F$t 9$X䏤܍(% j'@ X!$ Џ$A$m$ <p$̌ έ`8%'$A䏸 $ o<$̌ έ`8%̏$J% x$  X5o܏(% b`0%Я c` %z$i!4Ï䏦ȍD 8'H@-Ï) (Ï$ 䏬䏤<<$ּ 9$֠䏤܏(% j'@za܏'PK/܏D 8X'XD$ioÏ䏦ȍ 8'\@hÏ) cÏ$ 䏫䏤<<f$ 9$L䏤܍(% j'@D  pN`!(k  ` % Џ$bA$oX1 ܏܌eLfT D$eH܌eLfP D$ eH$A ܌eLfP D$eH m$ @ЏЯ c` %$pAÏ䏦ȍ 8'd@Ï$ 䏸䏤<<$ 9$䏤܍e V'@䏤܍ V'@\  @@̏ʏD't$''| T'x|N`! x!jy p-p!q! oo#L* !njM!X!ol#Y* Am4k8  T5` %o1  y` %e $C$u!!Ï䏦ȍD 8'l@Ï$ 䏤<<$< 9$ P  (% 0% ̃$y5䏫<ȍd 8$H@-䏯$ 䏬䏤<<$p 9$T,䏤܏&(% j'l@$lAl'tl `l!*܍F( 8X'x< <'%̏<<$ה$ׄ 9 c %$D@''$ %%%%/ !< /8<8y$BY* &$  ;$ ȴ$  ȴ$( s$, g%0$ Մ$4 g%8$ Ư%<$ Մ$@ g%D$ Մ$H g%L$ Մ%X$ x$\ ; ; %$ '@',(%@L @@<B$Md I3$a@` (% 0%@@  ;@$ Ư ;0 ȴ4 ȴ8 s<@D Մ@@d ՄD@ ՄH ;L ; %P ;T ; ; %,('H'84%<80,%8%<%$ ˴@$DE O(Y,(tD ȱI'lxD 0% L$@ E0@%D ՄB4P0@xJ$@ txtL8 $  "'|E` % Ŝ@0%@B8\$$ N8$ D L 0%E<@%D ՄO(P<Y@(tD ȱI$@ xD L 0%ED@%D ՄJHPDK$@tD L 0%EL@%D ՄLPL%%M $p!` %7(@(% b 8%I&1)* &Bd0J@4K<BKd$>T @(%%<,048''TPL诧`% %$ (% 0%@$ L$A$A$<B$Md I3$a%$(H< P% ˴$̌@$ 8P  8P $f -! % %(% 8/ % %$ ,(& <<$($ 9,$ 8 H*,K0@@0%& ȱ %M< 84@ ЯȎ$ L'#4`o<4@ $88$ $ L')@*4``0%& ȱ %K<$4@ L'@%%<$ Մ@ <$ ՄD@$ Մ$A D$AB<B%MdlL  8P :$DL ;@ %P  8P :$DP ;@ %L C8$X@ %38@ XP 8x@ X5* X $aT'L D$Ll G$a"d0M4L<B,d$>T  (%%TLP''P\XTPLHD@<8%폿\ov%%%$x %!08 q(:d'| Ƌ'xx$|$$$ B#@AQ$dBP!AX ,$$A$$ B#@A``! ``# `$d`#h ,$,l$.H/L!$ <79$' % O8% $$$dPRP! QAX ,$$A$,$l$ h@Mp!%$* <5$ ' % O8%l*  $*nx$* @%($(&*& Wذ!&iPjP%KkPlP$BbTxi$h!x!@@! P@ X!%l%x0!$$d( ÿkd` % $kd$ap$nd\8<@DHLPTX''0\XTPLHD@<8d$x$%%d3 \H%'I 6P!SbX0K`$$A`$lX$n  b4@@0%F o(GD<@@#i$$ J$ 5p@1PD/t8b0@@0%Fl(GD<p@x#x$$  5(i  J4@pD P<t8p<P0t8T(k$HLlh!x#y(eC%C8!D' Ƌ'DeKPJ$K`! m$y(p#xB/!$( ɀ8%)bb@$Dj $ LPK lh!0% .8%b@nDOPY$/!$ 0% 8%b@Dj$ITLPK lh!p!0% .8%b$A4$p,XPl$@#OPC%PCk(DFh#$8! HC%HCi!N$ 5B$@#"! 8!hX1DFL `b$AM$c,LPaC$aCJh# XC%XCKH!y$n(!C'!C@!H!"!P!@#oX1@ DFL$ $  8% DDF$L$$8% YDF$M$$8% Tb$A'HLK!A@!$AC H@"!n$l(C%Ch!O<P@ X#bH#FD$$ $ T'(o H4j(GDF<<H@i#n$ `&* jDF<$@8%M G\8<@DHLPTX''40,`l$a% % % 8x'@l%9$l!  % 8x'@l% %I+$na  % 8x'@l$ %"$@A<`&% V'X@1`Xl$%y\`% XH!*K$+`#X \\$B%\* \* $\\l%S(`(% 90%"< BP!Jߡ1Y ` (% V'\@`\c* $l\\$\\l%.`(% 90%\`\ Ȁ9X!l \ 9= (%@\\l%\%\* 揪\`<$t 0%' 9$4,0'`'Я$ A %$ % $$A( <d0X<B$Bp (%d0Y <B$>T (%<B$2 Ġ %'0'P$1@%H%P%X%8xX$1 $ yX1  <B%Md %@(%`0%$a HN8 $'% %@(%`0%1 C@@@ %eP 8x@@ bX0O4X%4X xXbX0Y $A`$lX%8 $%$'@'Я0%`:$ x!YX7(HX(% % $CX!b$cLX5MX* `o1d3( <B$Bp(% 00d5*d'0',($p`%%/%@ pEL' ?8%@%@ `#`%!%L%$'H R'D8H<D0!H ('P*8!D 8X'pL' ?'P@@%`%0`%,$('p'$ %0%`8% x!$( ( %,)  %`(%D 8D8, XK`!$ %- 8 (%  %.8$%H @@8%  %(%  0%@8%(% 0%@8% % c88$ '@%'0(%4,`% @%<<$ܯ$ 9 %Q$d %`(% L8%@@%G$$| :LL$DQ@ @X@@ O,$ <@%@(@,@0I4@8@<@@@D@H@L@P@T@t@x$  9Y$<<B$a4  |8% <BE($S % <8%`d %(%$ "$@ $ %l(,4,0'X'0(%4H%@%% P<f<$$ 9 %$ %d` \dd 8PKKd`\$a%Ld<L$4\` 8dd`\@) <f<$\$@ 9 %($;$,  $l K$ca6Kd<L$h\` 8dd`\@($ $<$ȯ % έ8%P$ $ l<$ȯ %8% έ P$  %(%% "$gP c %PL4K$d%d<L$t\` 8dd`\@) <f<$ߜ$߀ 9 %,($,( $ <f<$߼$߬ 9 % K1l x1<B$\ (%x5x c %$40'X'ȯ$ %` ;` % ; <B$d  I3$a ;  Ư( ȴ, ȴ8 s< g@ gD gH ՄL ՄP ƯT Մt x ; %$ '8'(D@د௧䌣%`<B$d `(%$a I3䏯菤<$ȯ ˴@$$$,  8( $,(& <<$$ 9,$ $ 8l <( ȱO<4@ L'|H@% Մxx8H@ , ȱJ$@  L'|L@% Մxx 8Ll( ȱMD`n$@ P $ "'(؎ Ŝ@0%@P^$$P$  L'|T@% Մxx hT!h lAl `)`%< B%d د\`(% C8$@d؎ D$؎ ;d 8P :$Dd ;@ %؎\ G$a  % 1%x3 <B$\ (%x5  x%D@''xD@x$x$% 9x83 5D$( D( T |$, L|( H|,%&<'@l xl-<|.@$ @(%8% 5 lSl'h Ƌ'dpl,A  <8!80 h,P!-<hP# PB/<0 hh#,h#P#,A  x</!/$0l@!,@d@# @B.@0ld#`#@# hdx$(l$ `8% ɀlop,A  Ȁ<9!9H  0 hXp!P!8<X \`!P#A@!%APC ,A .<0h \#`#P#,A  p<.!.l80H l`!@!8.@XHYLx!@#!%@C ,@ 08lp#,Lx#@# xtlp`0%@8% plt`8x$l$ `0% l( $ D0T.<@#9@x"x# `ll4$A,<x-@|0l 8% Gl&H8<x9@$ x ̀D@''Я$ A%$$#x3 <B$\ (%x5  x$A E( < x1l<B$\ (%<B$V Ġ %'0',( %'L Ƌ'H`@Ld@:8H 8P8'P'T @0%TXV\VT(H!L8jHkLK`!H ` 8'0 $`xLd@HH hL P@ X!L lH p@x!H0@b(! ÿ0!0 ,('`'X(0n@%,@%H%P%0o0x0yTPL % (% D@0%< BLPT%kd $a HN1% % (%@0% C0g@@'4@ ;@ 8P :$D@ ;@ %  %@M1%x1<B$\ (%x7+ x%,('H'0(%4,X% @%<<$($ 9 %I$\ %`(% L8%@@%?$$X :HH$D$@%Q@ @@@X @$@(@,@0@4@$A$ |1K` $e f$  % % @(%-$A$l4$$m0$| %5|f$e  % @(% % -$$Ax4$ |0Y $A@$| % -$ c %'0'p*8*%%@%*%h % -$'@ 8X'$'@ ?8%@ 'X'Я4'%b@$O1b|0Y 4h<B$ `(% 00 b|<C$`(% 00b|4IP%j|'0'0(%4,`% @%<<$$ 9 %O$d %`(% L8%@@%E$$| :LL$D$<@%Q@@,@0@4@8XPYT@`@d@h@l@p@t@x$  9O<<C$ƞL4  |8%<C$Ƣ$|  |8% <C%($Ɠ  % <8%`d %(%$ $@ %K(+ $4,0'X'0(%4|%@% h|<<$H$, 9` %$ %t x| 8Pcctx$c!6d|<$dxt 8$`tx@*$ $<$` % έ8%h$||K<$` %8% έ h|$ ` %(%% $h c %h4c$g%c|dxt 8'䏣tx@$ |<$l` % 9'hd`dl<$ 8Xc$s!w||dDxt 8'tx@k$ ||<<f$$ 9` %g|` %t V'Xt@^X |d<$ 8X0%S|` % t V'Tt@JT |d<$ 8X0%?|` %t V'Pt@6|` %%t V'Lt@-X LPK* Xd<$ 8X@0%LPX % `T dPhL Ůl  %\|<<$4$$ 9` % c %$40'p'Я%` ;` %, ȴ0 ȴ4 ȴ8 Մp x ; %'0'H8%<%8%<$ ˴@=$ 8P <$X 8@0%@$ < 8$d@ < <$򄯠 9$p$ 8P, 8< L'X8  %  %%<8''h<8%@4N1/ @B<X@K`#hC@ X @C@ p@nx#hB<XE@0%`8% `,Y<@(%K@8% ( < 5 P$N T4O$ $ 0$ '@h'+t @ D`p!v@vO!xz @AC$ACk`!| @$%~(X't YX& PD @h+`!t @t%v@`x@C'CyX!z| @$ p!~(X't YX P$K T4L$ $ 0$ " @`tN@D @#+`#v@hxh!x@N@'t#z@~xh!|$ ( Y# PX< D@ `#h#t@x'+v@h`!z@K<$o#| @'tm`!~( Y P$K T4O$ $ 0$ C@@C<@hH% L`cx#( % 5H%  Lhp#'+(` `8% 5F8X<`M@$ ` ̀ x$p$x<8''Я$ A %$$ ` %"$A$od( <ﯣ00xx`3 <C$D`(% 00<C$8 Ġ` %$A ` %'0'Я<$8%@(@`<@"@@$P@JX# ``# ``# ``# ``!%dpD`@D<D(P! X@KH#!H%`HL(%E %hC$C,l(%0@&(#hp! $< H8"P!D $<A *XL HH(H(%0@L!* $*L@ %$* HL %D@h!`!h!HL(yP!H0!@00@ ÿ(!0(k`!(!p@0(@ ÿ0!0( '08%@%b@e<0%8%bb$= %x+` +;` %@9<<$H$,@0% 9$$>A$=b$= %k`+` +` %@㏤$= $!l$!m$!  %$!AӏnϏoˏ-$'m8'i$c5<$l 8@*) $$a $<$ έI$a <$ έ;$$f %2$d!5į 8'@+)a %(a $<<$ 9$x$ $a`'$'(8 V'`@$ $dRį 8',@H) B$a$a <<$į 9$$ٯ'į '('@$ʯ$a$B  ' '('@$ | % ٯ$gį 8'4@z$a$a <<$ 9$$'į '('@$ {$a$B  ' '('@$ga @Zx* Ug C g* `8%G * xx0%'!Kt@x(!$ 9``tMx x$c@'*  $i1į 8'8@'+ !$a <<$0 9$$' '('@$  ($i8į 8'@@.) ($a <<$\ 9$@$ͯ' '('@$ |  %$mį 8'H@ `0% O8%$sį 8x'P@ `0% 8%$t!į 8x'X@ `0%  8%v$yaeį 8'\@[(a <<$ 9$$ [h$-h 8Pď(A @0%<$ 8@$hh%؏hX !E` V'@ :`' '('@$# b* $Ca%h`(% B<'<<$$̯ 9$ cD'' %$  p'H&$< @(%@@%e $ % @ %@@%< @h&$H< @(%@@%d ; @ %@@%< @h$ ȴ%$ x$ g$ s  %$ ȴ$ $ $d ; ; %$ 'X'p<8%%8%<$ ˴@$|& <<$T$@ 9$ |B b <<$$t 9$s   $ ÿ$dĎ8 I `   '\(%0%@8% [ '\@ <C$Ĝ :A0%p5p $  @$  ' $lHmL @! 8@ p@H@x! (!HXg`! ÿ0!  M/  %%<8''ȯ$ $ %A %n efg % K$$A$O<Y@(=$  %9$$A$ %( <<C$ Ġ %*$$ A$ A%$ ܯ<<$ jA p 5l p<C$ 0%p$x$p % %@(% o@0%$ '8'$ DH%L'H ('DD< % o0% <HL  <$D % B0%$܏$ '@',%40($LPTD @%@ %'L ('PT@%4T* &TD Y @% XD T X@%XC X#* #TT& K* %LT  %@%XP$mXL %LD Y @%P( XI %+XTLL* c4PX* [4Op1+BDdYP(* $LIX+* LT%M* %L* TO*  &@ %|D D %LT@% o@ %XD P`(% 8% L* $ T* $ D L$Ci* L`(%L@ % B0%$ K܏4$(,0'H'hD@<840,(%%%%s$@Ԯ@@܎Og%D F؎D EԯX'd@8%$ [E؎F @%  %@hJ$H%hYԏlH%  %@< S$8)lC؎" CC#p* #(!`%#(!$ % <\0%Jp#PX!!!`K܎Lh!M؏. OԮ@%X  %@%  %@hYԏlîHآ%D(,048<@'',(%, $ %(%0%@8%   (%0%@8% p$H$ p,('@'x840$(%%%%<, (<<$Я$ 9 %$ 8P$n!)@%'0 8@0%@#$ <<$ $ 9 %$'` (% @&dH@$np$EE %$E % :A0% @ %@q%$s!%$u'L 8@0%@$ <<$L$0 9 %]$'| %`(% '('@R$ | ` %K%$u!='` 8@0%@7* <<$$ 9 %7$* 3$&dHX& xtX% @@%P y<%ந!$i < %J$ % pp @= ; %&RT&1 %<<$8$$ 9 %$%<$(,048'' %$`d.x'L $HLP @%8 % %@(% o@0%  % `$ :TT$YC@%b `d`dA$ ` @$ $E`$ I %*   l*  @  %`'`  %($` % o(%$% 'X'Яp%0N!0O $A$<Cp$ 0% 4Y<Cp$ 0% % %@(% o@0%'0'0$%4@% %<f<$$ 9 %l$e lt % V'`@tb$t 8PWW$d9@0%t'$ 8dd@2W l`MH*X#NL ``! `@x!h $<  8(! \\$Ch`(% l$Ce*  %h``(% l % B0%%W$matt' 8@ t %h` ltl<<$ 9$$%40'h'௿,($ N`<&sP$` % @(%<9x<'x %'D<` %(% @0%)&1I 0<&s'D` % @(%< k6< %J6`@%P< ` %(% @0%Q 0 &1 <&s` % @(%<:X< %:X%<` %(% @0%Q 0 &1  :$@@%(%@ %$$$` $& @$& @$`%<,($ '`'0p'T4$ԯ,($P @`(%@PQ  <I&R0 $ Ġ@(% ; %% @` %@P @hp @h$p ;4$(,0'p'4'\$0 e@@%=%|Y  8Px 8PPP ! :$Tx@ % 8X'<I Ġ$T J@x<I Ġ$x 8P :$Dx ;@ % =$%@\ 5l \40'h'4,('X%%0p e@@% : %D%4p &@@%< S$A0 X8 <&1 S %BY@%D  B @ @=D <&1 S % BH  @%D<I Ġ$ ;@ %%4(,0'h'$'< e@@%%b$'H'ЯD@<840,($ 0%n4$ (%@͏DO ȯ($$-('7A(!& $<@$<$a$< a< h!ߡ1W $<$ $$A< x<$BxN F@ % 8X' 8P@ % B!O$B$>@ % 8X' 8P@ %B!$>X&R&V%'Y@#- @< S$Џ0' :A0%(*@<(D $(,048<@'0'40,($ %n4$ @/LQ  (<I<&R|&$3  " @ @=$  S@ % "/  @%$ Ġ(% ; %``%L @=4 $(,0'`'LHD@<840,($%N %/#@8!yY`%(%(A "Ю %PBP# Q@*!`%` %$` <\l+$ `,h!%a$a % s(%@ @%%$a$a4.x/!Ux&4'LY%LTP) % `(%@@%f  %  (%@% T* %@ `(%@@%f  %  (%@%,& 1l'xl$ ȯ@8% 0%$<@% @@(%@% ; %  @ %$< @@(%@% c@ %`L$<< ?$ $< L&&RxL(,048<@DH'h'௱D`\TPH@<dXL $(,%%%&1ߠ$-''$ &p!1 &&!(1  @$<$$ <  |<6$P' @M  &p!1W   <$ 8X$!4%&%$& %(% M$<<@%$ (%@*C j*X%d007$$0$F&x!3  %&F&@! 1*@ %```'< <$ (%@C noF%&!3(  %&F&H!*1K` %(% M$@%@^(A1 2(A6 0,$a$ 6$a"$a $a $a  <<$"$!0% 9%<%Ȁ%! (!J*X$Mp$5<|<$P (%@  <$"D0%' 9%$a$6$a $a  <<$"$"0% 9%Y  $ < %)"%IF&X!l1 $>&F&p!1$>* <'9#%* $&(a &A$cKA $@%K (a &A$cNA @%N ܏&%+ ܏@( <'9#D%e(H#' +!M$L '0%' %ԏ@%0P 0܎( 31I+@ %& = 0%@;4 ܏0&$ @=` % <,$#|'` 9&%&$ : %ܬ@^No SO b (@%X$((80% '$@%@I p &@(% <\0%4%wd@DHLPTX\`' @ <$cߠbp!1$>$-( $$@ $b!)1*@( %'ȯ<8% % B88<0%X$ 0H$0H  0J@<$c<e480 `0%080d$@(%<01 $,AA ,A[ ,A ,A ,A ,A <$4a0$0 808@(%0d @ <$%4 a0$@(%'8%'0(%4,$ H%h%%.<xx#y@Ȁ9p!/!%8&R>$$$ 8 % %(%$@g@8%b"S xȀYp!220 2%@%$Yr$@ ci5'X$ b @Z1((&y* O%&* K,C,&o* E&* BY%+ <$$$%$ %&$$%/JB* )) %(%@$& @ Fp$N F$  %$cj*$ $ % ]%0 $(,4'p'TPLHD@<840%(A# %p<n!s>%%%@'$%A%@@ % :h@ %(%0% <\h#x! % ;@#ȸ#"`%&&%K&%'$M-W  h<-!-TP'P,'P4'2n{P$'{'P'2x*2y P.P4. %@<(!(<&1%P<&1%<&1%<&1%<&1&<&1&@<|&1&l<y&1&2i w %C0,a qP<*!*0@i'Tg'\e'|<b&1'H<_&1'P<X'2k`2lP R'2l2mP$L'2mI'PF'P4C'2n2oP0.2o.P. 9%<8!8D</&1'<,&1( <)&1(0<&&1(h2y  2h@P,'2h@2iP'2i 2jP$'2j@ 'P0 'C<&1(<&1(`$a %2k`2lP0'2l2mP@'2m'C <&1)<&1)<<&1)x`$a$a %2n!2o@P'2o@2xP$'2x'P 'P4'2y 2hP'2h2iP '2i 'P'2j@2kP '2k`2l P'2l 2mP'2m2nP'2n'P '2o2xP$'2x2y P'2y  2hP~'2h2iP x'2i u'P$r'B$A$Ap@ %'$(8% :P!@g'P(`'P ]'PZ'B$A$AX< kx<`T$BxLQN %M$BH %@%P>'P;'P8'D E  '@(1 %.'P(D E  '@"'''' T'#P,D E  '@''p'|'x T'tx#'''$ 8X0%' % 7a'W* @%!$B2@ % :h@ %(%0% <\llhH#i! % ;llX#˸#`%& %(% 74!%#@$%T%HPLD@<840'',` 8P :$D`P ;@ %`<$* C8$@@ %P L 8PH :$DHL ;@ %P'tX$'X 8\`T @@(%@!``<$ 8x$+@<L$t 8'`<<$,< 8$t<<P$, 8$t`<<F$, 8$t` :T ;P ;LPl, ;` %,'`'$40,( % @ NP@%Ј!44% D 0%S$O T$X &&1@%4~%D 0%SY$  $< H*X+`%L&&14 $(,0'H'pL %H =$|@<%A$,  (%@@%z`% Ҝ % 0%@6$$ $t'l'p 'ht xx ,K+<<$B$A 9  hA$ $ ,''X$ 8X 8P'4$$'$J T$  h :$ 8P :$D@ % ;P< C %4<C$ԯ'` <ïP%LH''<84 %`,% * (%@@%`%* $ <&<$B8 9$B$$&9p& 8&%pP6`% 8x@+ pp @ %@%p @  *j m :įllp/ % ;ll`% `% 0%@ <&$BT 9'lp(( ; %v$hT$|) $'|T 8Php 8P@%!$c(ae ' :@%`+,ph<$Bx % 8X`'|0 8%)e p ; %p))` ; %`<CE,$ 'd<C@%$$ '|@% F %  %d % 'dT'|D@% T@%@ Tbk@@% <I 9$<48''pLHD@<8%DF4<5'h't'p'l'$,($  8%h`< 8X$BO$@t$$ap > %< 8X$B;$p3'p<&1ߠ'@"x!3 &@"@! 1*@@& $ 8`(%@(%'t %@0% 98%  &p&x#+ >%L8<@DH''%(% ('x@,$$d,$  '4,<C$<@  |8%,  ' 0%<0$B 0%4%'p'pLHD%f4<5'p'|'x't'$,($  8%p`%@|$$ax > %DF4 ¨i%xl1%<$cߠ%@b!3( &@bH!*1K`@ 8x&<@$cߠ %' ='l  #x&$Bx$BO+ &,l ( # x &@$Bx$Bb0#& % <\(%xDF4#$ #$ T(% @ >lLDH''`d`\XTPLHD0% dd,0%<5$ $ ''''',($  8%@ $$! ᏿d > %ݏd $ $|#$Ca{$R&1 %'d 7$d|Q#d,#&1 %'d 7$dx#d/#d#&1`  %#&1`<$&sB P&1 '<$$C` % 8X@0% 8x@(%@  @ (%@%3 8P` %$D(e ' :@%<x$CH %8% 8X|0 8%' ; %#L$RaI&1 %' 7$@%1#=+#4&1 %' 7$ @%#(.#T&1O  8P % :$D@ % ; (%##`9#(&1$B$BI+ .&1 >dDHLPTX\`''p<CDdhl%`$$$ Яl 8P\l`dh$$$I$ T\ D'`'Я4%T% 8P :$D2<$CT 8X@ %$ %'0T'`dn $o 0 :$$0<$C@ % ;bc`'8'Я% Ҝ $  hPP  P@ @%b  y @@% ; ; %'0 $$%$'$ Td  %T&h 'DD@8%$TH 0%H& @(% 'DH$$C $C $ 'P'40ld&  %&Lȏl @8@(%$$ $Xl <@%@$<$cD8%X\ P\&h 'TPl\@(%Y ` % >``$$\$\ ̏Ll 'T\@(%C 4 0'h'Я$%d0$h @(%0$ @$d'0'0%4 é<  J0<$''@ 䯢`  M%N$#D  s %$A'ȯ '@N؏<$D' 9 @=%'ԯ '@\'ȯ '@䏤 %  l(%<<$D$D 98%<$D 8X'L ?'L ؎ Ք'@ <$E' 9 @=J%  s %$Aؗڗ<*X!4!lh!* Ȁ8!@! 4Ԏ  hKh! imp!8Ԏ $'@ % :$('ԍA< I5JwJ A  pp!qn!X< H $%)OI C$Yb 40''($%%,hp épTX\)pp< `+h<$8'T'L dL@% $(b N%^O$( :PT@%XX %Y\  sH$A   <*X!4!lh!* 8.Ȁ8!@! 4# ,* hKh! imp!8$p $0%@ %  l(%h<<$EP$E, 98%h< ?$E|h ̖ <P5w )9 P(IP! Q `! p< - $'8 $ %p ,$('h'ȯ$ <4!w %x <%y$" $h<<fg$E$p 8X<$Bp$'8',( <4!w%<$E SDD%+C`$a 8" 4BD$$ $D@0% נ$@ $ @= ; %,('P'Я$<$ @$<$8 @$'0'Я%o be@fd@ `(%'0'Я(% @@ (% '0'P8%9%0 %N$cO%YX$c$Bf(YH% KIJ$BK%lBLM$BN%9OX$B$cY'(0H$cf$B `$ :@@$P` %!@ :@P4@ % <\1P ;4@@PPYK!$ GL@$'@'ȏP(%0%N)O%*XH$E < I%)%D ;00D 00$gPY0#K !$1 <\$cg$B< S$Fď'8'ȏP8%@%%n$Bo <$F(%4 S<4<$xh $BF$c<I'9 ; % %'8'8%<40TX\<C ذ$$< &1GX S % :$$PY`$ '(HITJ XK\L`MdN$O $<840'P',($ N`X('+!  Y(ID$@(4\%$ b +  P$0 ;% %, $('@'( %%,$ @C %NBP$7$$# o+ , B8$B9"B(bC+ @%@  (%@%  %  (%, $('@'p8%< !<9<$''h h| |# jb%K}k $@% Uw&@p@%'XȀ8!@!'\'d0% ~'`@/<$Hd0%' 9R|< k,<$` (%@ @%<<$H$H0% 9@|b G`N\Ȁ/!@!F ௮d :$d$ J`<K\<LMN |$ȬOdp''h hp @%<$H Spp|C  b<| @=%<8''4X\`d !<0<\$ 'TT@% $ X<\<$H$H 9$$ :P`PYdHhIb %4'X'$HL< S$H<HL9<$'@@ D@@ % $h'H',PTX\< S$I <PT9<$'HH L@C Xh(\jj,'P' %$L< S$IT<L<8$'8 <@@%<$I SDDp '(   ̀DD @= @= ; %$ 'H'< !<h<$8't'htx |hp C 'T$ 8X' "'Tp@(%B l >l@p @=$ Ŝ`0%<''$ ;$<<$ @$<$8 @$<$ @$<$ @$ "'ԏ<<$$H$@(% >$ "'܏<<$$HD@(% >$< <$'@'($%%, w0)8 P< IP! Q<*X!$p' '؏@% $(P %$( :8$ I@@ @@@@@ C$Xb 菤@%  (%@  s %$Ac<"@!A#@$ AC* 4d B@!A#@$ AC* 4f b@!A#@$ AC* 4h $d qp#p (%'`xX  )#Ȁ!PZ l ih# hp\ ·@M  (% ·'T@F |+9 `*`!  aL!C4(`8%G8`8%' "ԏ (% Ŝ@0%Џ@#|$ @$ $  %'t LԏЏԮ %$ 't| L %$'t L| % ȴ %%,$(''h @H"*%L V%* RL$A$lf $Alff `%!M#hl8% `!M#`8%`d `nd`h$$ P! X!tp~'pzvrx| LH'$'Я%%4 g  g g Ư Մ Մ  Մ$ @= ; %'0'Я  s'0',(HP% % 8PGG$f @@ % 8'@GP$'8G$r G@ % 8'@GP$ IG$sa H@ % 8' @HP$  H<<$J8$J 8X0%$%,('H$$ '$$'$'$<$BJP'(诿d`\XTPLHD@دܯ௧!Hp%( J*%$B%)$$P $Q'''$&(( %) % (%0%8% ʃ%/ OX!lh#9@!H#`;'Я %'' '@2@% 8!(p#/  /P#'K`! %(%' '' %(%0% ' %(%0% ʃ' (p!x# K`!# % (%' '*a )ԇȏ(#8@,ևx#O*8cևK`#*d؏&؏$$' ԇ֧ħƧ§@ʇ`Їҧ̧&s& %U&1d@DHLPTX\`''Thlpt x| `$ATx|hlpt  GT'h'DX\`d h p$A DhlX\`d TD'X'Я$<$p @$'0'<΁D@<804(,X\`"d<Ǘ(ǖ,ǕHǔL&1%d$D F! 2F43 3F F &&1F6BDO58!DF T$D0dXX\NK#am#$#(%A$# %C* "< `@ $A<! HiX!k $c@#P!q<`` $a< xȀ!$B@#"@!Dǵ(Ǵ,Ƿ0Ƕ48<@'X@#P# '  h##X p< x8K}$k b@#8%p#</#x/(!(#8#XXC$Cp# $< x#oXC$Cp! $< yK@#8%x##8.(!(#8#C$C%p# $< x#xC$Cp! $< xo%'H'@%L<4%%HD80,(x  s %$A$$$x$'$0X   " %  "  " Q@$5 & `8$!$xF % ̢ 8%@@%$*a <F<$JЯ$J 9 %$G %(% "0%@ '<$J 8X % % ? (%o$ &s5l &R`Я1c%x\$$0Y RN IJS$QX$+DW`$B8%  %@8%$  %(%0% "@0('0<<$K$$K % 8X % ? (%&$1$ %(%0% "@('h<<$K\$K8 % 8X % ? (%$ & %L(,048<@DH'p'LHD@<840,`d%% 8P %d$@%/%p%!(% 8`0%@Q$9T@$ 3P!K`%@ %`<$Kp0%'0 96%% & p@ `<$K0%'4 9%%M$m @%d `<$K0%'8 9%N bQ$8T$ %& %L,048<@DH'`'hD@<840,(%%%%%1$$- U#!@<(!(@ % (% V0%@NU$@ % (% V0%@FM$@ % (% V0%@>E$ 8P % :$D@ % ; (% ;' # 8% " %@8%% 8% " %@8%@ %`(% 0%@@%$ g||% 8% " %@8%@ %`(% 0%@@%$ stt% 8% " %@8%@ %`(% Ŝ0%@@%$d Ưll®% 8% " %@8%@ %`(% T0%@@%$ ȴdd 8% " %@8%@ %(% 0%@$% 8% " %@8%@ %`(% 0%@@%$d x\\$ Au` %  `(%r$ 8% " %@8%@ %(% 0%@dk$ 8% " %@8%@ %(% x0%@U\$ 8% " %@8%@ %(% c0%@FM$ 8% " %@8%@ %(%  0%@7>$@ %`(% 0% 8%@.5$@ %`(% 0% I8%@%,$@ % %@ % (%  L`0%@@% $DL@(%`0%  8%@ $D< 8X$K $$& %$%D(,048<@''T<0h%PLHD@84lt'<  s %$A$$$h(% 90%x@|$h(%@0% ̢8$@@%7$lt  (%h<I%b%,n$'%|$'@@8X#$b$Y~@$) lt  (%h`(%@%'D@0%8% 9 ; %* &1 %T048<@DHLP'h'$\$0H%4 %8<A$ 8'0$k'H@b@!$M- h<-!-'L@'P@'` 8X'T'`z@'` 8X'X'`r@ o@@l4i@f4 Ga@^4 RY@V4$ oP@M4 ȬH@ AC@@4$ P:@  5@ 0@ +@ O&@'` 8X'\'`@'` 8X'`'`@@4N(@bg'\DX (% @<'9K@4@'d48'h8<'l<@'p@$ 8'0\(` < I%Jj@@ ;(@` ($'H'(%,`h Эh<X9<$'X'L \L@% \ ib%*5j\h $@ @(% @= %`h<$Lx' 9$%$ :DD\$ L@ @P< EK<$询H 'LLH @(%<$LH SPHP b,('`'Я 00<<$L 8X$ <$B <<0 $@@ % y"'0' %$< S$L<<$ (%@<< S$M< '( D @=< @=  ; ; ; %$ '@'Я$<$ @$<$ @$'0'0%@$ :0@$ : @0 %$$  x! !, x! !$,$ $ $ |$ }$~$& + !+  !-D@0! Ȁ$#Ȁ#Yx!#p!!8& $n+ !+  !-D@0! Ȁ$#Ȁ#Yx!#p!!8& $n+ !+  !-D@0! Ȁ$#Ȁ#Yx!#p!!8& $n+ !+  !-D@0! Ȁ$#Ȁ#Yx!#p!(!8$b<LdN\Ox<%LdP%%X!<'9Ld" p!P%b$c@p! %$ !X@0p!O!y1yp!!/O!D!x!I! !O@$0xp!Yx!3/xp!!Yx!Dx!!I! !Y@$0op!X!/3op!x!X!/D!!8Ix! !X@$0yp!O!y1yp!!/O!D!x!I!  $|!$ $ .  0/0<'@'4hltX% <$M4 Spp<9<h$ pp@H   l %d нpdplt&% `% H%h%8%`w0< %JLd $x!$!.S8!$8!@ $A< x8#@x$$C\Dx!q1!O!Nx!08p!O!8Xx!%8!$ $|33|C\Dx!$x<T$MdLd`pX SP< Ld`pXPT%JLdx* |&<0&!9ߡh%38%,%%k`%)|0O 0Yx* 0Yh%%)0Y l`<p!ߡ1  `%8 %%,%`0O `%%4l'h#'`XT%%\PLHD@<8j < S$M<<$ (%@S yj @ н` %@H% %<&LdHk 1h`!$am&Bp!j!I$ 8%I#% % $ab!@ $A< #C%$a*a1$ \p!1x!*$ xy'x$  % 8%z {cxymp!yP!Kz!{ `!mp!j! !+!%$a$1aHLx!!%$a%<$M S`(%&B@H%&@%I \I# % 8% \8<@DHLPTX''LHx|%'d$3  %@d! p @! PC%!PC*X!p %$4 'd@$d$< 5B@'t %h O< 5)B@t'l0#$ %(! Olthpx|g#l `LH'x'0,P%% յԏ؏'h(%$h >ԏԏ1O$xh$h1K`$ ll$ l1Nopp1X$ y t$ t1Lmxx1N o||1X@$ y$ 1Lm1No 1Xy$ Z@a$ l($ 1No,1Xy01K`l41M n81O@x<1Y k@ c$mD$ {xH @!kL cmP roT €$ yX$ <LpČM<ȌN$@'h'P ̏P@%h '+^ $\ :ԏЏԍ@@%`H%`(%ȏ!!K$+EČȄįԯT$$ T@(%@H%@0%'hT 诩HT$ĭ \<  čk`<$x'`'P` dPTH @%<$N@XT SHXTH\  h  (% ̀TT,'' %$L< S$Nd<L<@$x'@ D@<< S$N<0 %    @=< @= ; %$ 'H'Я$<$@ @$<$x @$'0'<į ة< )<$'' 쏪@@%@  kb%ll'' 6ٯ@܏@ ď<$T ' 9܏$@nȏ(A 쏤<%OĀx`(% 8x@% $%*a 4 4 45ď Ք'@ ȏď<&$T4 9'>܏$A ďEf Ք'@ ď<$TL 9'܏e' 쯨@bЏ<%Tde''0% @8%$A$AiLJ hKh! imp!''''|$f ~'@ ďF<$T' 9$ӏ܏@ď| ďL+ ď + ȏď<$T' 9$܏$A!ď Ք'h@ ď<$T 9'܏|'h쯧(% |d@8%ď,) X*lX! YKh!'x't'' ~'@ ď<$T 9'q܏K <%Taď%& Ք'h@ ď<$U 9'O܏ďEf Ք'\@ ď< $U8 9'<܏|쏦'\'h |@8% ; :$< G$%)XI O< YJP<$ ''Я@ Џ` @(%<$UP S؏ԏ b< @= ; %``(% ̀% ̀(%%<''8P%TLȯ ة華Џԏ؏܏䏫< ,<$'' ď@% Čp %|Ď%0% Ք'@ ď<$U|0%' 9hĎ% Ք't@ <$U' 9X :$)9 P(IP! Q X!eďЏ@% ௬p/-!!%ďԏ ௩p䏤'tl@0%' (% | ̀ (%ďl ̀<$ %  < č)P<$ '' @%< S$UP 0 T @=%TLP'ȏ'D %<<D$U 8X$X<$BX<DL<8$ '8 <@C <h '9(i"'@' %$L< S$U<LL<@$ '@ D@<< S$V<0 %    @=< @= ; %$ 'H'Я$<$ @$<$ @$ <$ @$'0'84(%%<X \/ $(<%Xp<<$Xd$XH 9O$ "'$ "'(< "$X D D(\XdžTLJP$ hl ptx|d` \ % pZ&8@\ % pZ&@@\ % pZ&H@\ % pZ&P@X$X\ %(%$ ف$@ % _(%$%<48'P'84%%<d@D8<LHT P<$X'`$ 8X $'` 9$/%$$d % pZ&8@d % pZ&@@d % pZ&H@d %% pZ&P@ %$ % ڕ(% %(< 8X$X$%<48'X'804@%%%8%<$Vȯ ˴@$ǃXǂ\X\F"DO58!DF !D D0DD@D(FBF"TF0\XX\F$<EF"\X`dF"DX78!DF BDPDDFF"F$d`&& F <<d$X 9$XЏ $x p$px`(0%x$p p$Tx|@$ $ T'hd L@0%t@ 0%L$ ppȯx$T L'h@0% Մddx` )0%jp l$ $ |<@@4$<@4 'h L@0% Մdd ڕ(%%40''ȯ$ 8l%h ;t gx g|8 Ư8 Մ$8$ Մ$ '8'x$ ĬDĭ@ĢTģP%F,<E P T@DHL 8 <F,<E H L8<  %DN58!D F !DD0(%DO,58!D$F B&DPD0( /]8<HLǁ`ǀdF$F 2tpTP D @F2QF !|x(% /]'p X \DDF `F0<EǏXǎ\F.`dǏXF"<ǎ\EF.F(<E H LdzxDz|(%'``dh /]lǏXǎ\DD X \`dDžPDŽTF, F0<EF.F"<EF.F&<EǩpǨt`d D @(%'`l /]hǏXǎ\DD X \`dǓhǒlF,F0<EF.F"<EF.F$<E8<ǩxǨ|(%'``dh /]lǏXǎ\DD X \`dNjpNJtF,PF0<EF.F"<EF.F2<E ǥpǤt`dTP(%'`l /]htǁ@ǀD $ p%*A XC%AXC%lD@F@! $(DPD@FT, 0F DN58!DF !D$FBD0F TDX78!DF $D(F2!D F BDH58!DF TD,F!F 2DJ5A8!DF B 0$ D''<84ǃ(ǂ,pĤ<ĥ8ĪDF"!ī@DXĤL78!DĥHF 2$DD@F"TĪTDMīP58!D"H#F DDF"!%DO%58!D@%F 2$P#DD@F"TX#DY7!8!D+*F D D `#%+L* %Lǁxǀ|X\`F !dF"2DN58!DF BDDPF F"DO58!DF !D0Dpi## (% 8% \Xxlhd X`\Xxlhd`<pih#p# (% 8% xpxǃ(ǂ,) ~ F"BDX78!D F T$DDF"DM58!D"H#F !DD0F"BP#DO58!DF T$DDF"X#DY7!8!DF !D 0D `#p (% p 8%d< `< 8< H Lǁ`ǀdF*D TF D P @p`d (%F"DX78!DF !DD0F*D"8#F TF"DM58!DF !D0D@# pPPd`Tp (% p$< h %$ 8% < $< hx %$ 8% hx$ 8%$` <48'x',(%8<HLǁ`ǀdF&"F BD@TPF&"F A F$2DT@PF$1F&CF*"<8LHF$2 2F*CDžDŽF F$2 X \ǏXǎ\F*@DF.DDO58!DF 1$D DD@FBF.QF&F2<EF. ` d8%F,>E$F2`<8%E$F.8%F$`>E$#5pD@FB!&8D@DH .), KJED F&S 5kF(# KJED F&S 5kF(#DZǰF F0<EF F  @$ @$ dd@F pDPFP KLJ@džDF"0<EhlhT ,$h$ ,$`TǣhǢlDZǰF0<'&Th *l'& *ďTǣhǢlDZǰF0<EF dDD&8į .)DZǰF0<EF F Dž@DŽDF" <EhlhT ,$TǣhǢl F &&Th *lTǣhǢlF ǩǨǫǪx| lhT'x$ ,TǣhǢlDZǰDD( ` dLJdžF&`<E dDžhDŽlF, <EdF <E-dDD&8į .)DZǰF0<EF  ` dljLjF(`<E dNjhNJlF,P<E dF0<EF F ,(''0|xpthl`dX\Ќ%$@$Ď@D D(pD0F2! 8 <HLǃ`ǂdF$QF"2TP D @F$QF"2 F(%F(&ǤǥF*5F" F*4LHF(1TPF*2NJNjF $\XF FF !F*3| 3xdzDzǭxF Ǭ| 4F ljLjǭxǬ|d`F 2F(QF$c| 3xdzDzǭxF Ǭ| 4F ҂ DZǰdzDz$' `dDžhDŽlF$@<E DD$$c``aa X \D0D8F `F&<`dEǏXǎ\F.F"<ǏXǎ\EF.F*<E D@DHsrh id` \ X$$cDžPDŽTD0D8F, F&<EF.F"<EF.F*<ED@DHF d ehid` \ X$$cLJhdžlDPDXF,0F*<EF.F"<EF.F(<ED0D8F def gd` \ X$$cNjpNJtD@DHF,PF(<EF.F"<EF.F$<ED0D8{z $fgǫǪ%F*<E$``%F8P<%E$``%ǡǠ%F <E$``%F0<%E($(@ % )'a`%F <E$@F8<%E$@a` %F <E$@F0<%E$D$y%$( $cq$MǩǨDž@DŽDF$@<E%؎h -$DZǰdzDz$AS%h$ -$`DZǰdzDz$ARA%'& +DZǰdzDz$A'& +DZǰdzDz$A2!%,ǧǦNj@NJDF*0<E؎h -$DZǰdzDz$A%&& +DZǰdzDz$A% $\ X,(d`F F Æ4 }0DZǰdzDz@R $\X,( d `F F Æ4 }0DZǰdzDz@7 $\ X,(d`F F 4 0DZǰdzDz@ $\X,( d `F F 4 0DZǰdzDz@%ǡǠlj@LjDF @<EnЏ jF F ց$ \X,(d`F F Æ4 }0DZǰdzDz@J $ \ X,(d `F F Æ4 }0DZǰdzDz@/ $\X,(d`F F 4 0DZǰdzDz@ $ \ X,(d `F F 4 0@%Џ (%D D(F$2E$%$|ǵXǴ\Ƿ`ǶdǹhǸlǻpǺtx'',D`DhĦ<ħ8ǥXǤ\F,2ǯPF("ǮTĦDħ@F*d<8Dzddz`F.1ĦLF$ħHF(rD@ǰ\DZXF,4ĦTF2ħPF$bLHǪdǫ`F.4F0TF2qT ڕP,'@DD'DZ@ǰDį8Į<ĭ@ĬDF2sīHĪLF0cĩPĨTF2T8F0D<@DHLP ڕT'0'd`\PTHL@D8<l% :$$"h/l%H$L'8&<)PF&&(T+@*D$\%XǗǖF*FNJlF !F62Njh0hF*E 4F F  3 %`$dljhF6!LjlF(2F* 4F  3F &L'H$<%8ǃ`ǂdF&"DZF"BǰdzDz &T'P$D%@F&"F8F"AF"2Ȏ8pF(QF:$%ǦǧF"RF(1F8$%ǪǫF"2F(Q$%ǪǫǦF:RǧF"AD@F2F0ӂF$2FA*+ 2F"5F  3F F6%$F F*$ 4F632DZǰF4dzF0Dz 2F2ӂF  3F F6)(F  4F&FF6%$"DZǰdzDz"CF*%`dhl (p& PD@& FB!D@DH&$ 5&%'&)(F$2F(Q $ $%&' 4F*"0F&A<,(8*+T P$%F(QF$2\ D @()X*+F&AF*"L H bd,p& D0F1D0D8&$ 5'%$  ǧǦF*"DZF&AǰdzDz$ *+Ǥǥ 8F(Q%E$ ,F,%F0p>E,$,'@'د@%D<0 %@D  %TP0  X\`dF F$F"qpeF,pqd ihrsF p4F !d$F,Be h,i(q0jkf grsF,!dqpeF,pqd ihrsF p4F !d$F,Be h,i(q0jkf grsF,!d2ǭǬǯǮEF F F uF eĨ\ǫF@!F4ǪcbmF6l Ĩ`F6SF$FA!F&fF4!F&F.RhiDŽdDž`qF$qpF&jDk@ǨǩĤ`F4DF!F62F*bF2AdedždLJ`aF&`F*nLoHǨ|ǩxF(F<F"!f$g Ǫ|ǫxg@F*fDF<F<2F,Ad,e(F2䏥쏦ǭǬǯǮEF F F uF eĤ\ǿF !F4ǾcbĨ`F6F&mFA!l F6F*fF4!F&F.RhiDŽdDž`qF$qpF&F4jDk@Ĩ`FA!F6!F&bF2RhiDŽdDž`Ǿ|F$ǿxa`F>F&nLoHFF"RjDk@h$F<i F7DDi8h<'FDF.bF,rnjDǍ@F>!F>UF<5F2!F>B F64F<D$<  8%P(% ü0%P  H.XX$%CX3 $<(<$k 9$jH$B 1K`<D$ %<  |8%H<D$ ü0%X (%%<8'X'Я0H8%<D$<  44(%H ü0%4H  '0ǁ(ǀ,Ĥ<ĥ8ĪDF !ī@DNH58!DF 2$DD@F TDO58!DF DD,$0P(L$P$T,  3<8!8@C$C'Y#%F#F#@C$@Ch#F#g#HC$HCI#g#g#PC$PC j#XC$XCK#`C$`Cl#Fh!gp!$(,0'ȯ$@H8%@7H%"$%(8,90DN@#0#X#d %`#bDm4o8c p!!@!d0!Y4 @ %M8 @ %N<n@ %O@ @ %(%`8%  <<*HX3 $  y@ %$'8'ȯ$8$(D ,F !0D0D@DPF 4'@<$ ] $<8$n 9'$t0 . $L* $ ,m*  (.* 0*  ,@  %(%@ '௢܎$ :t$<<$n8$n 98% > >@ %@F$'$' 9' ?*$<F($nX 9''< @ % @ %$<$nl@0% 98%$J(,ǡD0ǠF2!ǭǬF((ǯD Ǯ F0bDMo!58!Dǃ@F TǂDDDF!DF&(P!<$n'DF(tDN58!DF DDPF!DF$F&bF"DDX78!DF DF!F$F&rF"DDL58!DF D 8XH$(ǡX!DǠF!ǭǬF$,ǯDPǮ F&bǃ@DOǂD58!DF D$(P!DDFTD<F2$n'DF$qDX78!DF 2$DD@FDF*F2aF"!DI5!8!DF 2$DFF*F2qF"!DL58!DF 2$D 8X$<$n'D 9'$<<$n$n 98%$<$n<$n$<$n 98%<&n'@ @'@h$a$FF(%$F(%<$&o 9' @'@h$<$o( 90%$<$o8 C8$@ $ :$<<$oh$oD 98%e<<$o$o 8X'D'D >4'@@%$ :$ ] $<$o'D 9'J'D$ AD0%@ $'D 90%'D$ AD0%@ 1  A %$ :$ ] $<<<$p$o$oЯ 9! A %< )(%$ C$ :<4$p 8X'D$<$p'D 98%'@ @'@<&p,h$!$FF$$F$(% 9' @'@h$<$pH 90%$<$pX' 98%ǭǬǯǮ <DhD`$ph'D 8X$'D 90%$$<$p 90%ǡǠ<DD$p'D 8X$'D 90%,<($p'D 8XC0#$'D 90%'DF!DD  DP FR'DPDX  'DFDD  'D F!!D D(  ǣǢǭǬǧǦ <$p'D@D(804 $ 8X$<$p'D 98%< )(%$ C$ :܎0 J $* @, * : (* 4 0o* . 8,($' 90%  %,(% '@ <$q 8X'$ ?'*$<$q0 90%< *(%D C$ :$<<$qP$q< 98%< .(% C$ : ; ; ; ;( ;, ;0 ;8< ;<` A` % @h'@t܏lp'x'Я,0%@%G%oL %4 G840eL@0% C8%8@@(%00%$ 9/% ǏD ǎ!F!ljLjF(1 F.0DPAFT!ǓǒF2 F.D aF"!LJdžF&BF.C<DD$qh'H 8X0'H 90%%,'0'<p8t R %thHXhph C8%@P@%p(%'l 6'p@lp$ :p<$h'̯$q 9' $l$a쏹pp'd 8D D(F F <Epdڏp'DD % 8X'Џpp<'9q<$q 9'ԏtp+E'` %$`p ;%h$-MÏph'p$c̀dDpd$cD$c%) $@D#$B@@%(Ae ' ;0%<$!9ߡ3*@& Dt&'d< dX!kߡ1lx DXxXb$c%`DH#$PwpD'0%x DXxX@D 'D'0%x DXxX@`'쏪HL%I)\pH$rbA$RA$i ' $ ''$x 8`x`@'$iA$IA$o'$oA$OA4p'@` % ` %'0% 8X8%X'd 90%@!@%D0NjF2!NJ'F*D %' DD 8Xp<%q<$q̯'$ 9't' '@ '`%p$ :p<h<$$r 9$q$<8'p'LHD@<840,(%%b%(%' Ƌ'܎$$ (%0%8% 缯@%'( 90%$%%@;$','`%`$$܎H %(% 0#@q%C `0%% % 8X(%(% 90%&R*A< $'4 90%%&+ $! `0%% %'8 8X$(% 90%&R&+ ʏ'@ 90%D % %L(,048<@DH''H,Č(%' Ƌ''H 8X'D'H$ 90%  @$'L'T<$$r 98%%,'D`D DhF!F,0'د<840,($%%%)%   %'\<$r,@ % 8X %@(% 90%&1 &<&sr<   %@ % 8X`(% %@(% 90%&1 &<$(,048'('X,@% %`'T 8䯨\T\F  TX<$rL0%'\ 9]$T@<$ߠx!3 T%*TB@X!l1T<T$ߠ@@%$ca $ia $ma$pa$ϏXDžDŽ$TF$LJdž$T F&ljLj$TF($TT@!3.T%+Tb@`!1@T@X`%,'X'ȯ :$$ :00$```` bee$ @@E N@$ :C0C'8'Я0  }0 ;'0',($ @ p%@ @$2  ; % ; %@@% @@1 @0  } %%@  @ ;, $('@'ȯ %$0 ; %%$ '8'LHD@<840,(%%@% @@%B` * `%d  &* `` %$ d%%$ %@ b"&b$c@k+% #%h!!& :pp@%VNO D%bc `@T &D' <\0%U !$(% <\0%` dU! !(!$$ <\`0%dTH! `%$B@`BD @%`% `j `@@%kru`!h!x#oc `!%@@%%d !%P!)A   d(% ; %`L ?L(,048<@DH''D@<840,($ X%%%h h'%% .& % `(%%@ % k$0 ; %0 43  %% ; %&%OV@ @%#HH#I= J@%@1+`1, 1- N6 PED %B@%BBe%D  ;@ %%  % H!3 # :$R@J @%`!h#M && <\0% !(!$ ;$ $"* @(%(%. / &  %% k$ ; %6%  %  #"S* S#(!(%9 ( &  %% k$ ; %6%  % D V%@%Bv ; %&D I%@%Bj ; %@ @% %l M%NEXX d@(%X d`DX ?D $(,048<@'X'XTPLHD(% ¯@qO * @gT'^T @ @% $S @%&sI i*  @ %@S &s@%%K%  0%@% h+h  0%'x [$ 'x@h h:  0% 'x@h0@ %`(%  0%` T ?TDHLP'% %n* `%c `@ O D C  Ne `%%  O 'ȯ$ %* +% <&RrȎ"*  S@ %"#"*   <&r@ S %&1R @%$ '8``%b@ @%b@%@%n co b',($ %p% <&1s S %&Rt<&1s4  S %N!%,@% $('@'ЏHd``efDg @,Oodebn ¯8H8@bx y` xyh@I&* B @JF* b '0'ȯ$ %% < `#&RsXnyh* |i$ j k x c `* $j$ @M@(%Ȯ #` "@ QC@%`b`%@`O B@9@!ڮ)  '1"@` KKB@ -p!#` S@ %#`%/ % * m  %$ '8'ȯ$ 8p<&1s0 % S8# (` %$ '8'$ %%,($#(a  ](a. :$@@@/ Q%X S9@%@ % vYP :$+@%K,L"@- M .%O8 #cccccyY`#ccccckK` v %%%%)  v %#(a %@%H%c,/ ,8X$  ; %,)a  d@ %y#"@"@%B"%L&lP!@%A (C%A(C8%5!8 $%` @H%`%c$`* !Y@H%$B* )A %` * @@%`%c$`* * K@@%$B* )A   v % %,%  ; %#/ 8  v % v %#(a g1 , $('@',($ %N @8@Tk$OY%'(XH $) P :$ *SJKKB, %1  9PS`4XH'Yi P!Jqr $P :$ +K,LMMB.9@!1 s`P%,  %   % ;*0  % ;KP, $('@'H%@%$ `%8%b* !$nox 8y ` %H ;@H@ $ `8%c `$D8H@ :4D8H@4@EHI+K " L $(% k@0%'@'($ %%%40,7<<&s&sp%N!@"A S % y( ; %s% S % :$ RTiIbs`4 $(,0'H@%%ED* $c D* DBތE% j!%0b'40,$ %%($ `d :$(h :$(lo'`03*  $ @0% 3* 3cb1܎0b`%@`Q30  @0%13b@%B@` % X%1%%lCX!l1hȀx!@!&$D$c`>lC!K1l hȀx!!l&!I1*@ hhc`!m!/l&!X3 hX#P!L+h!l&!Y 3. `hH@!  X!&j`$$cl ;hh ;%h4 $(,0''40,d%%%%N.  H P#!*!Kdlh!7M$c`$BG#@ H :LT@ % <\0 ;TH :P @ % <\0 ;P LH !1 d hmp!%4,0'`'LHD@<840,( $  $$$* (  <$t$ S(%d`* @q5h<<<&sup&u't$ %l%<<$t| S$tT& &. S %&@&1 8< S$t!(< S$t*d6* <<$uT$u,0% S 8%  %@2@K` %f S(% MR d`%'d`MdUC<<<<<&su&u&u&v'v0 ( %@dQ0&` % S(%Q qR@돩d`%d!`( % S(% E $ S %fd<$vd S(%`<$v S(%@R<<&sw&v؏(%  @-@% Q($ F@@%Q * (!F S %B@@%Q +% S` %B@@%L(,048<@DH''`$ :$X@%@ % @$4< L'@8$< L'@$<PT$ ''ȯ$ %40% C$ @h %$8 Մ$< ՄT1<D$r  (% ; %$ '8'P$ %0' @@% $ Y')LI$ :$ J@8% ` ȱLP $hx$  L'H@$@P *@$ xh$I'H L$(% %  %$ ''ȯ$ 8%%88$ Մ8 Մ @= ; %$ '8'$H@%H%$ $ $ $ 840@<P$ L(% % >THTNLP<@048ON$"C`Xx* Y NKC` OO*  JC` X* _C` Y* MC ` N* LO$%%)'H'Pd`\T<%%%lhXLH쯠&Rߠ% :$$@O@@N@%" @KH :$@% p#N!'Y@H  Bk(`;c* 6e +@v*+@v*+@v*+@ v* +@v*$+v* c* @ &p 2` %@u`#&p  %Ďk(ef % S' % 'Į ' OC* * ! %** {@$ q&bx!X!(1  _&% % $c`C!KK`!1%` %$ca$B C؎/$!#;&d %&p ; 0% `8%b  (%& [@8%  %hh) ؎0 % * 3 ; %` ؏ ؎&%!؏H* د؏"L* ** lh!  '* l  llHLPTX\`dh''$ %8%%%n$ȀH!*(j$B@$cF $( :L<L <L(% <\0 ;L <%  px!'$ 'H'LHD@<840%T0N$Ax$T4 0%' `(%̯` % %Ў @% 'د(%$ [@8%  %LD%`1 %h %(%`0% '@4BI@ % ` %c`@% %*! k ` %@%,* &` %(%0% C$ ; %dY4%%% %b&1@% !LD (#IHJL*X!k` $a<a C* #`@ $A<  % @%h!%'h<$w@ %@0% 8% 8Xd@0% ?8%@L L048<@DH''0,$%%%4( BD4 U4%@%Bu4 % 3@ %0 ; %% ; %u`%4 $(,0'H'`TPLHD@<84%%%(%VO<$ 8% % 5`BrP `4b@g J G#g l<#F  %(% `g   %(% G s  % (% `0% 5 s`u|pp3*@k`i<6RB@$ emp#%0#[bF* P P!K+Elg '| O %p1H莆c`#L|nh!$  %(%APC$APC*8# 5s  s$AHc`#L|$nh!  %(%APC$APC 5*8#s``,rbP @"xFy  % (% . `lFn  % o(%% $s` "Lh!Y* H#+@'8Fl#.H$h#  % (%dT48<@DHLP%d''\XTPLHD@<8%@N1 x@yH* lDmL* <`%`xT3 &S$ @ %@ %LT`(%h$ &/MTP c@ %*\T1 q@ %,T1BFDEN<8%O@XY G 4<'w$ $ $'$ kx jt Lbp!* mK#@H%cI`!q! I`! b!* I`!"H!I`!* H#BO@ED<#H#$  0%h%h@%B4DE Ȩ8%u*v@ % l',lw@ % @ %0! ӎB S %ώBX$4 *  ,@8%x!1BMDEF< X@%4 ,LL* N@ %(% | 0% LX* Y (%$ ̀LP* P%* B@FDEHlh#$x#  5LP* P$lTh$mT\8<@DHLPTX''LH%4P%`PP$bn Nx!* !X* dc`PP!#* PT0K`4L T<D$rD8H0  (%0H8D @M* D* LHX!*  Lc*  T5 T'@'$ @H4  @@%H48  $8@0%b$@`(% C$T0O<D@ $rT4X T$ '@'XTPLHD@%Q4% aT$ %p* @% 't(%$ [IT Ox @ %@=Tx   %@&@% @ %@|xx$x   % @%`$   %@% % (%0% C$% @ %@؏xp"T0H<D$r (%p"Tp4J jTT@DHLP''ȯ0%E48$ C448@4noDT!X@hy(H!IDjK<xh#MHn@#0YL YP<D$r`(% 44DT4JT'8'HD@<840,%%@(%4  @ @@%4E` %0% C$d @(%b)T1*@ q` %d @(%e4@%` DlL`@%D  L!* qD*D+LK!!&C %B* $LL* d @(%Gb %$M* Ld @(%@%b'x'ld  (%0% 8%ltpd @(%$ [&G  %` %@(% 0% 8%@@%@@%n c#`` %(%0% C8%t ; @&Rd @(% ®q@%"T0I <D$r `(%BT4K TD,048<@''(%%,$ $%$ %T* @%<"&sw@%1 %.  %@%@&R S` %"T* @% %, $('@',lH%NT1 hd q\hd\BD* I@@0%BP* IH@0%C4`Nxy X!f* b@AIHh@L ,* @@%   'L\TX OTX\D* @(%b@ LKl!,L$LNH* $xlX#%y`!b,@@%< S$x%,'`'HD(%%L@l pl<F<$z, 9$z$D 8PKK$a@%D' 80%@$'Lp$a$aF< %)zdl<$zH 9'$E $ %lF'\@% (% '('`@p$p$a \lF'T (% '('X@$\`%TXL L  L @ L `L $ LT`\X- % $ TL`\X ) c%L@$+`$,p1 $$<C$Ĝ :A 0%.p5/p$I8܃K$b!sKD' 80%@mKp(A (A l<F<$z 9$z/$E $ %)@% pl 2"p$A6C@%b@ $+l%G "0%L$+A$jJ$@%%Gl 0%@$$$AX$`%l%G "0%l :l<<<${ $z$z 9$#$AllG`(% }0%@l$lڭl`(% 0%%K$c_KD<${ 80%@XKp) F<%{tl<<${H${, 9$E $ %p$a @%%l<$x έ8%L$a X%l<$x8% έL%l<&Y$x ˴$g)@% *Ď +Ȏ ,̎$ $  %(%0%@8% t@%K$dKD' 80%@Kp(a (al<F<${ 9${[$(a W&$&B hlh/<lE @(pȀ2H!TdP * pl< %k{$<p px!d   @ ` $ $ $  %(%0%@8% $ $ (%0% @8%( @=#`` % w(%&D %(% %$.D %%/D $(%hd$BXh%K$l!HKD' 80%@BKp$! $! ll<F<$| 9${$lF $ (%@@%$p$A0%lF $ (%@$C c* $f`0%0% % %(%$ $  %(%0%@8% %K$nnKD' 80%@g* fKp$ $ pl<F<$|< 9$| $pl$D : @%&$' @PP@ @(%X! $cyp @'p@@(%8%)DlF '\ (% '('`@^$$ ` @@(%V%$ \ '@@%N%8%@(% %.PP`@%plPp :A0%Pp$* $c ;@ %3%K$nKD<$|P 80%@}* |Kp$ $ l<F<$|x 9$|\$F % $ (%@@%%lF'\ (% '('`@p$p$l$ X TlF'T (% '('X@$$ $ '`\ [@8% @ %@% 0%@ @ %@%䏩X$*  '菫TK* '%' (0%l(% :A0% @ %䏥 (0%l(% :A0%%K$rLKD' 80%@E* DKp$ $ ll<F<$| 9$|$lF $ (%@@%$p$lF $ (%@|$Co* `0%$f&D$ % %(%$ $ %(%0%@8% ^%K$r!?KD' 80%@8* 7Kp$! l<F<$| 9$|D$F % $ (%@@%<%$ $ '(%0% [@8%'  %@+% ('tl't :A0%  %@%K$ra D' 80%@* 'FLF< %}Xl<<$}$$} 9$%L@DH'h'8%H@$ '<<H@(% !$(@ :HH@8$@%D$YD$ `f i```` `$hD`%%KD 'H'ȯ$8@%n<$ (%8@@%b  $%@<$}' 9%$'8'Я00%`` % ȴ440 Ư44 g44 0 Ư44 ; %'0'(% TH%(a K$hP*%+D 8%`%:(%1#@H0!nD* @ %`8%$$c(oD* @ %`8%x$cD* @ %`8%y$c"D* @ %`8%l$cD* @ %`8%$$c%"`H%<E$, %`(% D$'0n#'0%4,($ t%%bD* t$Tt * %$R$$Q%$'P(% @$d@tD q* C* sx! @ %@t4 $(,0'p',($%% P$A$.p56/p$A&$4$X/ <8!8 $ $$$$%03(H %)p$!P$*p$ P$A$A % &/(%$A % &/(% % &(%P 0$DAh$ 0 % &/(%D0 c %,$('X'$ p%1&9D$A$A'$ $      $$((,,4 808@ <0 DD%$`' % $!%$( %  ?'@%p0Hh J*B$`@$D'%%o`a%k a' ao$  % & p$ !@$p`%$   #  D'H`%%`% % $H & %p5  p$ ''pp1'0P%H%$`!%) A!%J A!(A$ 0 &$ph$p''$TH%,$"$ EFP '<<P @@%(%L %.P<L!$DP+ %b$c$d+y $&T<L L ;$'P'@LHD@<8$@%%a'@%'% %@(%0% 7ȏ@%6$,2@(%$% 70%@0%( % (%  ?@8% %@ %b<&1ߠ<&1ߠ#H!*1K`$-aA'@(% %0% 7$Llȏ$.$e'! %' 8$@ % e @ <<$~,$~ 9$I %*& J %@(% 70%Bԏ`%"h!1 $+A$-A$e&@"h!$ea %'0# 8@Ȏ $Ee Y ')}IȂt&H@ @%@ p  %Юb iK =$.@@%L$f $Nn p0#$& 8'@$ |$lx&xvp0#$& 8'@q|< &$ .@%@f r  '(%0% [@8%  %@|8$A$ff$f<$~D' 9L$|`ЮlN  %@ Џ %m O@"!3) &"P!K1l@$+%$+A$-A %(%`0% (@8%@% %(%`0% )@8%@%@<$~x' 9$L8<@DH''@%8% %% 8X''0'$ LP@%%8% H @$F@H*  % (%G @ %$ @< (%@<@ %8%C * L$g&8% @@@ %L%P'$ 'H',ht<%ߠx!H%3P% $l$c h!1` %'`0%dl 9pd`<p%ߠ@X%%`l h!1 x$c!,1b`H%@p!1$+$-b$c@ !,1.$c/ %'i0#d\p 8Xd\pX@"ht@(%dp (Xld$+pX @(%ht@0% )ddO`%ht@0% )̯ddF`%9$l!? %' i0#dp 8XdpX@4$+lNx!Oh p dp$DEd* hD(%Y+(#E@(%h ¯dtD d* $`%%`%,'h'P($ %%%, @N €#0* Qx! @ %@X 'h0#% i @%, $('@'P($ %%%, DbQ* @%Qp#nB@$E `$EE X 0# x, $('@'P<%ߠx!%3 P%K%J `!1P0%LT (DLToD$l@H%C0#0` %'(LT8 8DL0T8D@( 8 'k$la<C0#0$~` %LT8 8DL0T8D@( l$wJC0#0` %'0LT8 8DL0T<8D@:%ߠ( 7$h!!n1<'x$9 '+* $ %T DTD@U@%PL%ML$I$/!<!y$3+` %e$;@%l$w4<C0#0$~` %T8 8D0T<8D@%%ߠ( "$h!!n1<'x@%<$$!"!k1l$e$ %@%%@%'H'8THL@D8<04(, $ĒēĴĵF22E.ėĖ Ĺĸ F F8<E F><EF F F<<EF  F><EF F F<<EF hllĹĸ ėĖ F62E,F4%E$``%%F$>E$@ĕĔ  %F40>E$@ %F(>E$@(%F6p>@%E$%%F*>E$@  %F8 >E$@ %F&>E$p$%p$$F22ĕĔ  E x%F4>E$F8>%E$$F.<E$F2@<E$%F42Eh$ F*<E$F4 <E$%F6<EF  F<<EF F F>p<EF wǧpon qpF0p2EQF4<EF2<EF4<E$F8<EptptǩpǨtF(<Ept F><EdF4<E`F2<E\Z$F.ljF2LjF$U F2<F6@F2F&vF8F F*F:F&#F,tpEF:GF,<EptF wF4`<EptF F,<EptF F2`<EptF wF8%F:QF$<E$@F4<EF F F <E F2<EF F F <E$ǧpǦtF>は| 5kF&ǩǨ|F(<E%$$c0DD\ǡǠ\ǵ(Ǵ,Ƿ0Ƕ4ǹ8Ǹ<ǻ@ǺDǽHǼLǿPǾT'' 40L$%,($(% +H@@%%%L %$Q*! $$(% +0%S&1%&12 %$rH$HL ,0%D D(F$2E$%$4 $(,0'H'4(, $Ć楹ǃ`ǂdF&"F"BĆĄ ćąsrF&"DDF*j F"DkpF F2U 5kF pǃ`ąĄĉĈF8!ǂdF(2ĄF"TąĈ ĉF8!LF(2HF2F"T 5kF2Ǎ@njDDZHF `<ǰLEF F"F,F& DD4F F bF*DF8<EDD4F"F"aF&"F8@4ǵǴǷ Ƕ$ǹ(Ǹ,'p'@@D8<04(, $ĠġĔĕF <EĥĤćĆF& <EĉĈ īĪ F*@<E ĥĤćĆF& <E$ĽļF4<EēĒF <EģĢđĐ F0<E čČįĮ \F.`<XEi$ǁ`ǀdF,DF WF2DF0aF4F FF>rLHǣHǢLF6<F 2E F &ǥXǤ\F$F6<EF ǧǦǩF&ǨǏ@F8CǎDF:`F"F F"F*p<E6%F8F: F F"F&p<E+%F6`!F,0F"F"F.@<E$%$ǵǴǷ Ƕ$ǹ(Ǹ,ǻ0Ǻ4ǽ8Ǽ<ǿ@ǾD'ǁ(ǀ,$F !DN58!DF 2$D@DO* $,* , (F TDY7!8!DF DDH* (0"* 0'04(, $$D Ǜ(ǚ,ǙǘǗ@ǖD$F !D $cF!!CLF %F4F4įĮĭ F4sĬ$īĪĩ0F0Ĩ4$BD F&s$F2cF0cF00F,sF4F8cF"RF.BF,SF(bF:BDN58!DF B$DD@#ĩĨĭ(F4BĬ,īĪ ĵ8F2dĴ<F&AF0F"PF04F8F.F0F.F:sDH58!DF sDD pF!!*X#F %bF4įĮĭ Ĭ$F4sF4īĪĩ0F0Ĩ4$c$BF&s$F2cF0cF00F,sF4F8cF"RF.BF,SF(bF:BDN58!DF B$D@D#ĨĩĬ,F4Bĭ(Ī īĴ%x$@@%$%$c$$ d(H $L4 :<H4>$cgd$B`h 8P'TTh$0>La>U$1j$1a$yU$a$ya$nL'T'_ 8h_h@$R$n$tL'T'_ 8h_h@$tC$t$fL'T'_ 8h_h@$ 4 $f$oL'T'_ 8h_h@$o%$o`L)A 'T'@0% 8hh@$  L'T' 8hh@ % `<d$' 9$%,'`'40% Uw@{@ %(%0% =,TA @ % ]  %<T$L %' 9j'( =4L$A8 ]  %<T$d %' 9L =<U8 :$L8$ =D@(%8OL ]  %<T$| %'į 9L =<$ ;7L =<@$ ]  %<T$ %'ȯ 9$ ;#$8 %! 0% =' $A@%%$a <TH$ 8X'L % ?'LH$ ;HH$ 40'P'h ''H$@0% % G4$@=$ %`2O,$c0X"3( 1*@ ``# `h!'( 4J$c`$  %$ G4@0%@<E$`| $ <%&2@%< %$<@%J&"@$ &B">:P% &Bb40&B* <<$$ 9$&*  %F(#0 Ȁ!!M$$BdMpx!!XYMN $BXYMCN&R&$&* $@$|<%8$ `@H'<$p` % ; GT` %` %$ =,$A ̏ ] <$@0% 98%} % 8PЏ@% (% GX@0%P ̏ ] <$@0% 98%g(%0% G`ЏV` % GhЏV< ] <$@0% 98%O %(%0% =,ЏA)̏ ] <$  0%'̯ 9: ' GpЏ@  ] <$$@0% 98%&̭ %$$ =,ЏA( ] ЏЏ<$P'Я 9  Gp'@  ] <$h@0% 98%.'d<$ ; % GT % %$ =,$A ď ] <$@0% 98%ԏ %(% =,0%@ Gh %V   ] <$@0% 98% :%@%$ * %Ȁ!bMNx&12$cx!2Ȁ Gp'@  ] <$@0% 98%Ȁ!E Uw XrV  ] <$ @0% 98%x@D % G|(%V % G|$V ď % G|$V$$< 8P$@<$@ % GX@0% G$$ =< %& G<$p 8X' 8P'$' GX@0% G$̏ p.x! =< % =< %&0*'. ȅ䏸 =< %6 =< % =<Md  =<  =< $ =< =< % =< %@ %%$ Z/(%&12& ;dDHLPTX\`'', Hx HDHD@'@8% :䯠,@'H'$ %@C( $$ : $c`!$BA :$<%T$ $ H@I@ @@J $ :b< %d$ $L@@M @@N$ :<'t$$X@@Y @@H %"* "$ $ :@<@ % <\0@g* <XK!$cg*@ $B ;@@< $ 'P',`$fH%A @%$i$s9l;*e-J/ X$`%D'L$ \ 9XDL\X3@(%8-$sA*$t&$d"%D'ܯ\ 8xX\X@D (%D'௨\ 8xX\X@D$D'䯨\ 8xX\X@ $<$ %0%' 9&$"* @ (  %T\ ]XT\X 9<$瑬 %'0% 9 $98P!C``%c,'X$v$$$$ $ $ $ $ $g< %)ߠ"p!1$C@$C$$MA$$"!*1K`@0D$ 0D$ %&$&0D&&$g< %)ߠ"`!1$M@$M$$D&$&d %h< %)ߠ(x!3 $g%"P!K&1lv&h !$"p!&1$&j$" !$&$c&$\`$$eA(Af 7$[A(A\ #$$A(A% $ A(A! $ A€h$"Ah$CAz$g(AD $;Ah$MA$gh$]A(A^ $\Ah$bARh$tAW(Au $nAN(Ao $fAGh$rAFh${A(A| $vA@h$}Ax|h%'x@LDTPH<840<%%&$$$  % $b&sX!V%!(&^ %&e c0%@@%E$ 8P@ %@%0P#J*  %  %`  (% % ;@(%!$[A$\ %`(% _}8%@@%"`%$\A&s` % ^'h h&hm!@ : %< 8X$$$%T048<@DHLP''$ %L =4L@ @%$]N$O7`%' 8PP8H#I(#$ %@ P ;P8lh!` <I% ;` &  %$ '@'HD<L@840,(<<<%%'ޒ&&$$p4 &sN Q@ % $QT0!O&1W&^&8&1<'X%y$ !&d&1&s&d ^'hh) 4 I Q@ % $QTj&1*h&s%l) hp< %$M<$0 90%%$ Q%3L(,048<@DH''HPԯd`\XTLHD@Ď%#<&$$||Q!PQ&R!Pg$y  % (%q&sO&R$$@(% c0%@@%$ 8P %@%3P#J* ` %  %` (%` % ; (%.p!$ $]!1Ѣq$$&E _}8%@@%`%Q$@ % ^'bn&sO!Q!$$3( < %)$Iȏ<$D 90%$$]!$ &E$" ^@%$ $&E0% _8% @%$lJ$ AhV&R@r`%$\Q!`!K$ a`!Q`!$M$" <$\ 90%<$ 90%M$@%`&s7%0$0Џx %!Y>@#$cH!I$B$C`l!Nx#!HYH# P!LJp#nh!Y M>@#$$c!X #$B@%|$%L|毦Ȯ̏%d@DHLPTX\`''ȯ%8#$* 8!8! %8 :48@ %ex0 <\0#80eyk%H#4 P!` j %84 ;0840`!%$hmn'8'04,($ \<&ߠx!%3 &H!*1K`$"a & bx$"L@%%$P&$[${a"$'P$\&C  % ^`(%P !C %$}a${ &1${a&1`c% &$[$]$\a'P&. % a$O@%N%$P8 %&C % ^`(%P!`$[$!$[$ $[2%$$a$; b %I@% '%$P$[$;aP!%P!K1l&#\&` \%&&4 $(,0'X'40,($ %8%$$$['P$\$]B % ^`(%P'!&8 % a$Y@% %$P( %& b %I@%  %$P@%&&4 $(,0'X'Я$${%$b$} @b$c@"`%b<$ߠx!3 $_ $(b$_H!*$c1K`$(A$bf$d bx$)$b'0'h$$b${`%H%AX%b$}$c`P%@<$ %0% 9 #{%b$c`@%Q$c<$ߠp!`P%1$_ b$_!-$c1j$( #Y'$(A3`@%<F'''9@'' %$e$)8% ^@<$'<j0#@8% 8X ?'< %/ #' %@(%`0% C$@% ` `%' % ;`%$''%40,($ < ;$f%$'xptŀ| f$'T (% d %@V%ŀ+ < ;$M%ŀ :$`@@%< ;$ C%$&\pt| f$ % d (%@&]5%&]PQTX i %I )&"$$*P$ATQ%lQT1% %/ &0 8P %R+ % 8P %@% i %@@%TX%4 $(,0'h',($ `P$`%%t(A  < ;$0%@%$Bt$d fʯP@%% d'L@@%y%@@ % g(%L@%L3 L($H$)L*p1lLh%-N$|$`pp'L$B d¯p@@%U%@ % g(%L1L9$!@$(L)1j*`%,p$|%` %P$ % fʯp@%@ % g@(%@@% % g$ (% i %@@%` `p$)$'(p< ;$<%``@%p"@ $)A< ;$L%< ;$\%@%, $('`' 40,($% f$p\%`$$|"$) 'P e` %@@% %P/3@%@(P)1K+`%,@ % g(%p%`@\ f$ \4 $(,0'`'$% P e'@P@@%%p$*F $+G$?H@@%o@$+0$?H< ;$hy%G$y$ i@F 0@$ f(%$?$+V$*F$ f(% f$ % g$@(% % g$(% f$ % g@(% f$  % g@(%$?$+;$*G 0`$ f(%$?$+1$*G f$D % g@(% f$@ % g(% f$D g@(% f$  % g@(%$?$+$*H$ f(% f$ % g@(% f$ D % g@(%D g$ %$?$+$*p%p< ;$%%$ 'P'(p,$ `B&Rp f$ \p f$\p f$`\7Hh f$\&R f$\P$]$- % f&RP/$]-$-# %P$]&R f$-PPQ&&)0* <p ;$%0*  f %&0* &R % f&RP$]$- f %J$]A<p ;$%`&Rl5mpp$ d'X@\%`XN3x%O< ;$%< ;$%H<p ;$% f$\D&R fݯp f %`*5Lr,&D<$ Hp@@%< ;$h%p(ABh! $*a$+aq$P`$K5xXN5Y f$\pD f&R&p f %?\$?Qp(A@ #$)Ap(A* $$A&(A% $(@p&D$(A&D$+Ap(A, $*Ap&D$.A&D$^C(A_ $\A(A] &D$[A &D$|Aop&D\, $('`|&'x&%ŀ%%ŀd``$e|`%|&'xN&D$B|ŀ%ŀ|6'xN6ŀ%ŀ@%$D+ |y$c+$ ''x$ <% i %@@%$<<#<0#J $ '8'Я %'xno$ g$d'0'ȯ %$%`< ;$Q%.\$< ;$I%"T<@E< =` %@@%%T&X 8 %@/T& =@@%<.%<ň8Q % g`(%$$%P`% % =` %@@% % g(%@$%P =&@@% % % g(%@$&@ %%$ '8'$(ńŌŐ%`8%@`$$B$c@`@`@`@ $` $B$c$]4 gį040@%ń$(%'0'x,40% i %@%,( %p<.!.ńň%ń(%ń*@%ń%lńń&%& 8PLL(A @0%ń 8xx@%ń!ńń =&@%ń%*ńńe =&@%ń%~ńń$ % gįl@ Ō!Y lHq$o%ń$ % gįd@ ŐXK!LdM\$Z%.$N&ń& gį`@`L$` % iń@@%$!@%H$0%F$ $(%$ń&P_ hTP_TE* @% %ńK  %XP gģ_XP_@$c$$c`!$m鯌ń% $< ;$(%  %< ;$<%4,0''ȯ$ ń$N$-%@% @%p<.!. 8P %@%9!X5$b&1"&-$)$ =@ %@$$&1& =@ %@$ $ =@ %@$&1 & =@ %@$< ;$P$$ %ń '8'x%11 )!`%$A!#!'ȯ8$ %$ %<f$ 9'$$$'8',((%%D@<840 <<$ 9$$$ 8x'@$$$p5#x!$ܯA 䏸܏' 6'@@%%$%@\<&Rߠ$\&"䏫< %J,$ojh!%` Cp!1cC$B`Cp!`$d! % 8x'@& %0P!E 9=@&(&(%' 6'@?@%%`% %h! 9=@&&1.* & ;/* $&* &$%!%0% =8%$A@%܏1P!'dF<g$L 8X@ % ?@(%%% ;%D(,048<@''($%,H% @%$a <<$疄$h 9 %!$TP %0% =8%PT$aD % D8%@<$ % 90%$ : %D 8X' %,('H'$$8% @%<<$௠$ 9` % $$% 8ͯ<<<I%b%n$'8'ȯ8$ %$ %<f$ 9'$$$$'8'ȯ8( %$ %( <f<$( 9$ *$( $e $D< ?@<D@5$g <$$L<D D0%<D5 e 9$$$'8'x((%, %<f<$t$X 9 %$$$ $e %0% =8% $ 8$e %@(%0% =8% ;$<$ 8X'D % ?'D,(''ȯ8$ %$ %<f<$痼 9$$e $'8'p($$%%40, <<$诠$ 9 %V$ %0% =8%@ @%$A<$ % ?D`%$$ % '@@%:`%, %0% =8%R@%@$A!'L<&$$ 8X % % ?(%  %0% =8%S@%@$A<$@ % ? `%s%` % :į`%4$(,0''80$,(%%4$  <F<$|$` 9` %M$E` %' 6'@@%D`%%4%E!` % D8%@<$` % 90%%$E ` %0% =8%@@%T$%$A$%$A'P<f$ 8X %` % ?(%&19* & ;`` % :į`%4 $(,0''d`\XTPLHD@Č$( %% <f<$쯠 9$$q8$t$<&Rߠ$ $0$#$-$%̯Ђ9y#Ă& %f$\  % ^'&)!&&1&f$\$ J #,l$ $@&1Ԃ&' &1$+Fp!&&&1$+Fp!1$* H %Ђ9&1Y@! 1*@$*Џ`x V'@v&%&1  %'( 8X0%&&$.$.&&&1F@! 1*@$* H %̂+&1K`!1$*̏< V'@:&'&1  %', 8X0%   &@&$l$h& &1$h$ $ h &&&1& &=%& D %$l V'@$(Ď 8Pz@% V'@ꏯr$ D V'@ޏ$)  b$@`%@< %) ЭI$dAЏ(Ae 2$OA(AP $FA(AG $DA(AE $E@揪$EAӏ<d 8X$@$GAɏ$XA(AY $UA쏫$cA珫$oA(Ap $fA(Ag $eA؏$gAӏ$uA(Av $sAɏ$xA{ď&%&1n* %!* @$D :| @% % 0% <\ȏ$| ;ȏ|K!  % <\`0%p!   % 8X'ć % 8X' % 8X' 8P %"@!) 0$Ǭa< I% %< %\$$ ;$d@DHLPTX\`''@<840,($%%Dp$$'d'0$e'8* <&<$$ 9 %R$% % `0%@@%J`%&* &1$ 8x(%@*&&1* <&<$H$$ 9 %3$d &% %0% =8%)D&* &1"%$ 8x(%@&&1$ 8x'@@ &* &1<$T % 90%$% %0% =8%D$(,048<@'p'($%,x% @%$a <<$皤$ 9 %>$ % C8$@@(%3$ %'t V@<$ ? %'$$at$ % V'D@<$ ? %$tD0!'L'H 8Xt %'L D$@@%$%,('x'H@<8(%%%D <&<$$$ 9 %G$$ 8P$aa1$ 8'L@*$A <&<$X$< 9 %,$% wn %@ &<$h % 9'T$C`  %$e0% :Ac` %%$ba$c$ 8'X@$A <&<$盘$| 9 %$% wn %@@%o%$ca $c$< 8$@$c+ $A <&<$Я$ 9 %$ 8X'`%$ca:$c$< 8$܃@2$c+! ,*A <&<$$ 9 %$& @'@4$$CC$$C$A %% 9=` %@ %`(% :A0% @'@%$ca%$d$< 8$@$d)! $A <&<$D$( 9 %y$$ @'d 'h n%$daU$e$ 8'l@M$A <&<$t$X 9 %Y$% wn %@.C`, &<<'t$眠$ % 9B$$ 8x$e@!f% % D8%@ <&$ % 9'x)$'| % %' D8%@'%c$eaF$g$ 8'@>$A <&<$$ 9 %$% % C80%@)$ =$(@'%|`l% &@h,% ` %@C d0 0jC d0`' %$ga;$l$ 8'@3*A <&<$8$ 9 %$&@ @'@!C m1h$$CC$$C$A %%t 9=` %t@ %`(% :A0% @'@%$la_$l$ 8'@X$l+ R$A$|`'f4 8X'x%$A7% % V'p@pm$p|` <&$L % 9']$pj4*X!p|@ pM4BD@p@D8E< 8<I%?%<&<$t$X 9 %5$$la#$l$ 8'@$l) $A <&<$睤$ 9 %$< 9$@<'%$laH$p$ 8'@A$p+! ;*A <&<$쯠$ 9 %$|`` %%` % @'@#C h1   |$K(a$CC$$C$A %%h 9=` %h@ %`(% :A0% @'@%$pa9$s$ 8'ă@1*A <&<$$ 9 %$& @'@@(% 4$$CC $C w@ $A %% 9=` %@ %`(% :A0% @'@@(%%$sa$t$ 8'̃@$A <&<$L$0 9 %y$@r%$ta$v$< 8$X@$A <&<$瞀$d 9 %\$ ;'W%$vaB$ 8'@<*A <&<$瞬$ 9 %C$|`& @``` @'@#C n1`$(!$CC$$C$A %%\ 9=` %\@ %`(% :A0% @'@%&<< < %JH%)%<<$$ 9 %$D8<@''$$%,( X%'$r e<f<$矀$d 9 %($e %'L 6'P@L$L%P PP % 90% LPȀ@! %@(% 98%L& * P ;%, $('X'0 $%%4,($ h<<$矰$ 9 %K$ % V'\@\C$\A=%\d'T'X'd'`d %0% 8% 5@@%*`%\$BA\X@(A%(A T :$D<I'T X`X <\X P!@X` 6%4 $(,0'h'84(%%<0,( %<f<$ܯ$ 9` %v$e` % V'l@m$`lx%||) '`'x|` % 0%'| 5@@%R`%l& * ||l쏥||x` % 90%#*x`!@%D<$cߠdH!*1K` &@b`!1` % 90%* |x!' ` % :A0%&|) ` %' 0% 98%%<(,048''($8% @%<<$$ 9` % $$% 8<<<I%b%n$'8'0$%4,($X %<f$,` % 9'%$n%H'H'LH` %0% 8% 5@@%`%L(H&R*@돥Hd' 8X@0%%4$(,0'X'($$%%,  p<&<$d$H 9@ %$%@ % V'l@l$ll$ $e 8P$ ' 8@0%@<7B@h% @ % V'h@ h :@ %<& $x@ % 9'f$hl(* ^%)l%@`'T`@ % 0%'` 5@@%M`%`ll& * 쏥`lh`*'T \ \\@ % 0%'\ 5@@%,`%h&* \\*@쏥\\<l$BߠLh!3\\%\(HH!*1K`\\@ %` 9$\%, $('p'0(%4, %<f<$砸$ 9 %$e % V'd@$ % ;'`@d$da`%`AC*%C*` d<$ % 90%$Tdt% ||K`||'T %'t'| 5@@%`%d&* ||돥||<$  % 98%q$`|P* x) tx %'l'x 5@@%]`%`&P* txK`쏥xtTp!|@<$cߠb!3) ||%K|b@bh!1|| % 90%|(a H9!'0H % :A0%H&xK`%- %@(% 9$%x %' 98%%4,0''0`$ %%4, (<F<$H 9$,($Ed'\ 6'X@\$\$P%%XE!$ 9=@\P\&1(* &dP$ 8X'X ;%4(,0'`'H$ %$ %<f$X 9'$eL'D 6'@@@$@D<F$d D$D@ 8L<I%bn@ ;%$'H'Я 8x'0'h@$%D<840,($ <<$$ 9 %$ :$ W@% 8P :$D@ % ; %%' 6'@|@%%i%%$ %4P!E'l 6'`@m@%l(a ` ;<t`!$ % 9'Z$` ``` ;<<$H$< 9 %B$ 8Pl$Qu %` 8P$C%# ! :$@@%B`%% ;&lu  !$` ;`` ;&si* &< F%k<FE$H % <8% ;% ;  %, % ;  % ; % ;`%D$(,048<@'',dh|`<%΢dQ$d$#$A%'X` VT`T@XA$X%<d$|' 96$<"!9ߡ3(d'X` VT`T@$$|X*4K`#Xm48%%XX%|` Xy4cD`X`h%,'`'h0(%4% @%<<$碤$ 9 %>$ % v'$Ab#1$b#$c`|p@!$%a| %0% =8% ` % 8(% %@(%0% =8% ;$!<$ 8X'H % ?'H |40''Я%n8$  @ %C <Fx%H%b'0<F%H%%'ȯDLH@<848D%%' @(%|@$O4%$Dx'௩ |'௪$x|8D&s>&R& % 8x'@a` %%` %% 8@(% % (%@0%8% D܏ ;#`&C %@D@%D<'($ % 0%' 9?$ % (%`0% D8%&R&s` 8D<<$ $ 9 %)$8 %%0% ='$A@%%$A$D'l<F$( 8X % % ? (% $A< %kL$$A< %p$  %x$' PЮ|L%48<@DH'8'ȯ$ 8 ;8 80 ; %%8 ;$ '8'(D84(%%LH@<0,(د% Ў<%ΤP<<$ $ 9$&&"@%O$-X<&d'0 8x(%@$&& Ў 8x (%@ *&&$*H* ܎ ;I@@%$` 8P :$D@%$@%<&RߠDH!*1K` D$&1&P % g5(%@% ; %P <$p0% 98%_$&'8%X&*  <'$N8H%%'x%c`Џ ܏܎E'< D8%'܎E'D D8%  j( %V8#$'H 8Xv0#܎E0% D8%l(h#M!vX#E8% DK0!@ &<F$ 9'P $&&s&R'T%L(,048<@DH''pD@<((%%%LH840,% <<$䯠$ 9 %$$-&o&'`'X 8x (%@&& $ 8x@(%@ $&&y$ ;I %@@%$ 8P :$D@%D@%<&1ߠ$H!*1K` DD&R&d%$&$\P % g5 (%P<$ %0% 98%$@#ؐ!P@d 7H#$ d % D)0!@ P< $4 % 9'h{$%R %P*0 *: & P@  % D$S@֢P&F/&B-&B+&B *! P@  % D$@ŢP*!  X!HC(`wh#M!`#  %$ DL0!@Oo&B&R&B@0%P@%  % D$@(8o7'l%)   % 0% D$@'p%% ; %%L(,048<@DH''0,$%%4 h<&<$h$L 9 %E$%& % < %@ <&<$祌$| 9 %1$/%& L8 @ <&<$祼$ 9 %$8L% @ @ %<&<$诠$ 9 % $ @=d<L% 'XdI %4,0'h'ȯ8( %$ %<f<$  9$$$$e 9$$$'8'|p(%%xtl@H% %<<$H$, 9 %$ 8Pf<$ߠ$s$D$E$O$ $ *$ %$ $ $]ff$c@%f$$c %x!3 $f$cp!1|<'9pV$pp#p'Lπ!&' %$dg $Y*p$b<%麗?$$cX $F$S$fO $X $n$cF$d$d(e '$d(P $[$F(F $F$d$F$F< 8X$ $$[$X(\ $X$d$c$Y(t $f$f(g $e$fߎ$o$dڎ$x$dՎ/!f$cfH&$s<%Φ$ % :%8% 'L2 %Qx!&R& r8!T*AQ!.!Qx!8!Q!(.!Qx!&R, &0T8!*A &R*A & lx$ ̏د,(04䏸D@8< ,8T`%'LLHP =TT* 4@%n'[$F!` % 8X't%  %`0% D8%@Z<& $ % 9'x8 ;Z$p&!` %'| 8X0%  %`0% D8%@A&Rx!%  % D8%@6&RȀ!` % 8X'%  %`0% D8%@%&Rx!F!D0D8` % 8X'%  %`0% D8%@&R$F$c$d$fx&RT& 8 ;4 8X'%lptx|'@'8$%<40,($p|'$|| |<<$P$4 9 %E$||]2Q '\\ %(% :A0%Q&R .%|I@% @%Q@%b @ %`(% :A0%P&Sb$c@Q&R |bB %`(% :A0%%<$(,048'p'@H(%Lįȯ <<$秄 9$h$ 8P$c, 8'@%$f$ <<$秸 9$$ 8x@' 8Aď'I'y%$fE$i 8'@=$i$ $<<$ 9$`$$$ 8P ` 8@ #$`ď$ 8X'3%$i9$l 8'@1$l$! ď<<$$ 9$$Ď V'@$@ 8Pb+ p!XY %$l$l 8'@$l)! $l$A <<$\ 9$@${@%$l'$m 8'ă@$m)a $m$ <<$稐 9$t$ 8P'̍ 8X@0%%$m'$r 8'Ѓ@$r$ <<$稼 9$$  9=@ď''ܭ9%$rm$t 8'@e$t$A <<$ 9$p$ 8P V'@d$$ea 8P' 8@0%@ď$Ď V'@ :<$ 9'?$Ad*%d* b*$b*  $!N$B@į 9(!Y%$t:$t 8'@2$t)! -$t$A ď<<$L 9$0$Ď 9$cd< `!ߡ1 Dbd$c%$t:$t 8'@2$t) -$t$ ď<<$| 9$`$Ď 9$d<$!9ߡ3)  Dt||bd$c%$tm$t 8'@e$t$A`$ $ $A$ $A' <%Ω<$' 9y$Āā %b@ b$c$$ 9xx!$ 8Pxďx#b(!$$f %b@ b$c$7%$t$t<$ 8@ $t)A $ < % $t< 8$@ ) $<%{<'<<<$$ 9$LH''X@<8(%%%D40 <<$窐$t 9` %$ 8P$a!I@%<$ 80%@B* @$A <<$Я$ 9` %$ 0%" %@$u$w$r4"4 B4@b$c@ 8P@% :$D PF4@@% ;$D<F$0 G` %@j ; %$$d!f$i' 80% +*8Z$A <<$$ 9` %$ @%" %@$u$w$r5"5 B5@b$c@ 8P|<F$0\` % J>0%@&@%|OX& 80%@ \` % I35@ ; % \` % J>0%@@%h%$i!R' 80%@L* J'$$A d<<$@$$ 9` %P$<F$0\` % J>0%@@%$u$wD'l0@$ rlD'm0 0@qD$c0@r$c`d',d` % 90%` %'l :A$` %& :A0%` %'( 90%\` % J>0%@@%<<$`$P 9` % $<<$章$` % 0% 9$D048<@''40 %$0y 0o'0' 7aP 7a'P*K`! !$( '\X :XX ;$X$ !x$e 7毥TT$ b!y$e 7毥TT $ b!1 @i$ r k1 $wn1 @$uo`@ '4($'$ 9$X($X %0% =8%X'\*@% % ;`< %k : %@ < I% ;@ $(  0o4 ;40''p0$$%%4,( <<$$ 9` %0$'$ ` %@@%'`%$` %0% =8%R@%@$A 'L<f$ 8X %` % ?(%$a%`` % :į`%4$(,0''@( %,( %<f<$د 9$($$p(%'`(% UwD@@%$X ;X I  %@%D ] D<$ 0%'d 9$%,('@'0$%4X% P<f<$箠$d 9 %S$ed % ]'T@TJ$T @H! T A$AT ]  %d<F't$ % 9'l$ PT A$A$P ]  %d<&'|$ % 9'xT T  %@$ PT ;P40'X'@$ %$ %<f<$@ 9$$eD ]'<D@<$< 3 ''%$'@'p<840`!C$&o%@%H%x'\@$B@ %%%& Z'TA@ %G$T Z/T ;?%'\'X@ %%%&'T ZAP1$\$#L'`'`(% =D$@@%A#`! :@ % ] @ %<$@ %@0% 98%$  L#`!@ %(% 90%\(%\ =<PTX @ %@$ LL<048'`'$$@% @%$ <<$쯠$ 9` %$ %D 7pLDL` % V'<@<$< 7p%$'@'P(L% <f<$ 9$)$d 8P{ Uw@|${$d!9{ 8'@2{$!|'JKF<'$0' 9$| < $/@@%'|O' 8`| 9$$/h%{$r!8{<D 8$L@0{)a +{$|< %XM| < $.|$/ < `@ b+ | 9$ `| 9$$.o%{$e-{<$ 8$d@%{) {$!|< %JpJ| < $.|$/ < ` @C+ `(% 9$u%{$t'| 8'@ |) |$|'WX| < $/@@%$e 9$| 9$L%|{F${$r!*{<D 8$|@"{)a {$$< %&M$| I$A'8'ȭ(%{$wA{<d 8$@{$$< %M$ٯ{$e{<$ 8$@{) {$!$ < %JJ$ {$e{ 8'@{) {$|'ǬY{$a!{D 8'@{$a|'L| Fl'$A6 8X'%{$i&{< 8$@{+! {$$< %)I$|' Fl$Av'd%{$i{ 8'@{) {$'gY${$l!3{D 8'@,{$a |<<$ 9$Q$| I'$A ] <$ 9'=$ '7L{$m{ 8' @{$!|'H| Fl'$AD 8X'%{$oa{ 8' @ {$'(Np%{$r5{<$ 8$$@-{) ({$!|< %J0J|'h I$$$A@% ] <$< 9'0$h!h'h 9$%{$s#{ 8'4@{+ {$!|'<H| Fl'$A.D 8X'D%{$sa8{ 8'H@1{) ,{$ |<<$l 9$P$| Fl'$A ] <$ 9'Pr$% 'lL{$t$$ 8'T@)A $a|'\ML| I'$AϏ VE%<<<< < %JD%)$%'9 'ԏ<<$籠$ 9$+$ I,K`&-19π-3;(@- `$a$a 'hj'l%L''04ptx'P % 8X'ppt$'t D8%@x$x % 8X'xpt$'| D8%@x$x % 8X'pt$ ' D8%@x$x %F 8X'pt$ ' D8%@xr$x % 8X'pt$ ' D8%@xb$x % 8X'pt$' D8%@xR$x % 8X'pt$' D8%@xB$x % 8X'pt$ ' D8%@x2$x %F 8X'pt$ ' D8%@x"$x % 8X'̏pt$ ' D8%@x$x Vpt$' D@8%@%$%40'p04A$@#'$@A$ <$BP$ A$`<$B\$`A$<$Bp$A4 '4A4'4A'''($%,P %<f<$粜$ 9 %<$e\ % ]'L@L3$L  L\<$粨 % 9'#$L( %( % BHH$A % ] H\<&$ % 9' H$ 0c %,('P'p$ %TPLHD@<840% @%$a <<$ 9$$|tx ]'@$ |t<$ 9'$0%%'$$ $%%  I0 %!@%$c` @  KD$L @ ` % I` %@%` %%s+ 0X 0Jt :t ] |t&<$$ 9'$#d 06d 0J@ $@  `%t$&R#U&1 x$a|t(% 90%|t0% D4@$ $$ Ұ!x$%t' 8X0%%T048<@DHLP'p'x$40@%'$ $<<$P 9$4$$x :x$@@@@ @@N$|@%(%$$aa $ra$wa$ $D$ D $ D <$d' 9$+a D D `쏤%$~i! ` %`(%x Uwx@@%` %(% >4@s ] <$| 9'$'`'T 6$@z @%'\% `%'X%$ $ `T&\X& ZT ;WX$!X\$! =< %<<$Ƴ$ 98%AX I'( @\$a <<$Ƴ$ 98%, \\ I',\ I'0 ]||!O <$ P S|P|#!P 8X'4 % A A Z/ ;$ =< ; %$40''$$@D %D<f$0 9'<$X J'<@ D<$L'< 98% $ 8P'< :$DX@ % ;'$\+ ` \dL<$'H 9/$\l p!dPX C(%PX@$ (% J௨XX 1 %d ] Xd<L$'L 9X$ 0c %,'`'x@<8$%%%D4$!$F<%εX<<$<$ ` % 9$$$$! pD< 8x$p@p$X!E`` % ]'@$( &`<&$0` % 9'P$&#* <@`< E`!ߡ1` % V'@"j$<@#* ` 8P`<$L 8@0%@` p`<<$h$X 9` %L$%@9't(A$ @% %'$ J0%@% * 1K ` :` % ] ` %`<$` % 9'@$d 0d @ p!t` % (% 90%P!P#@(Ap %@ %x$ !Y!@%D48<@''`$ %,% @%$a <<$ 9$o$ldh ]'\h@ld$ldh V'Xh@$Y$$a;8%l 8PTlL T$sa $cL'DK 8TKT@%$ca $elL$ K 8'LK@$e$$ea llL$ 8'T@l $ld<<F $@ 9$0$\Xd Kt0%$A%d ] d<$d@0% 98%\$d 0d %,'`'ȯ8$ %$ %<f<$答 9$x$e W$'8'@$ %$ %<f<$䯠 9$$eD ]'<@< $< KD'\ 8X@0%%$'@'H($$%%, $$ %@ % V'@'S$<&<$4$ 9@ %I$' <,''%@ %0% =8%@@%$A 'D<F$H 8X %@ % ?(%+`%&' <,'#8#Ȁ8!@8!8!ɀ(H!*X#D @ %F ! :ǡD0ǠF2!D<F($DPDX 8X%, $(''X8%LHD@<4yx!`'h'|$$(% X'$A @0% ]  %<$ %@0% 98%]`E0 $ R$ ` % 8X'hE%0@ % 8X'p<$ %`0%8% :䯠;`C0 t@% $0<$ %`0%@8% :䯠<$ %0%' 9 `C t $@%<$4 %`0%@8% :䯠<$L %0%' 9`<$` % 90%`&$ ;'t(% =D$@@%A `! ]  %<$ %@0% 98% `!t %(% 90%(% =<$ 8P@ L-$ !oL`L48<@DH''`0%4,($  :$TŠ %OŠ'd0% F$%'h$=!&%( &)$  %`(% D&&R< F%k:$ %'l0%$a HN4 $(,0'H0%@%@%$ =E %E$B$%# `%$cXK`!@$'`0%4,($l ` % '`$A @%``$X*  :$`@%@ % <\0 ;`'(``XK`! 8P` %@%p!`l(! 8x$@-42@! ;`l 8P" ! :$@%2P!B@ % ;`(%!$ = l& ;@ %Š 'p$  (%`0% D@8%4$(,0'h'$%%%` %$= =HH@@(%%C#%#$D8H :<H8@ <\@ %@8!< $@ ;%$'H'` %$ @ % 'H$A@%! ;0!$cb@b$cŠ 't (%@0% F$$ 'P'(%%,$ @(HP$2.< S$ŠO@%oŠ<P&1@% S %xY% ; %%P2( ` %'x0% C$ % @(%2)@ % V %%, $('@'`,($ @1%%X&R$B&BȀ@ :`@(%@T%%TH!$ 8P :$D"@ %PX!e ;&&1T@h!, $('Xx$N- p<.!.''<$B<$B'<$B'<$B''''''''''''<$B<$B<$B'<$B<$B'''' '(<$B$<$B0'0<$B@'8'@'H'L'T'\<$BL'd'l't'|<$BX''''''<$Bd<$Bp<$B|<$B<|$B<y$Bw'u's'q'o'm'k'i'g'e'c'a' _']'<Z$BX'$V',T'4R'<P'D<M$BK'L<H$B<E$BC'T<@$B>'\<;$B9'd<6$B4'l2't</$B<,$B*'|('&'$'<!$B$<$B0'''''<$B@<$BL ' '<$B\''<$Bh$-  Ip<.!.C'A'?'=';'9' 7'5'3'$1',/'4-'<+'D)'L''T%'\#'d!'l't'|''''''' '< $Bx<$B''<$B$-  dp<.!.8^'<[$B<X$B<U$B<R$B<O$B<L$BJ'<G$B<D$B$<A$B0<>$BP<;$B\<8$B|<5$B<2$B</$B<,$B*'<'$B<$$B<!$B<$B(<$B@<$BT<$Bl<$B<$B< $B< $B<$B<$B<$B ',hl8%(a0 (a: $-a$.aZ$ lxp'` 70%p``$.x$"$.b%$.a $ea$Ealx$"!9$ lx'` 8䯧pp$" x#`h :įppD D( F& 2E hh<l<$缔$| 9 h<l<$$ 9)$`*@$  %$ l % 8Ppp#X(# p$ pl ;%,'h'$<$BߠCp!P%1@% H%$C!+1l$S xhpld %'X 90%pdlh"X$.a $ea$Eax$"5Xx %'Llp 8䯪hplh !x$"@ %p :įhpD D('& hF& 2E<'X<'9Y$L l< % #$8aK(a9 $6aF(a7 $5aA$ $7a<$ $:a$(a; $9a2$ $<d$ $^ab$ (a_ $?a$(a@ $>d$ $[a$ $|bQ(a} ${a$ $~aT$|$ $'h'<FTPD@<X''A%@%%%LH04% j0%@^@(%$b@ %(%$ 8%@T@(%$ :@ %<$`@ % 9'tE$DDg$ A(A$(A ZH<0!ƻ@%@ %(% 8%@E@(%.@ X# b ` F ! `@%,l4@ -+bxDD  F(2Ex@% l@H'H@%l$!$!$!`%@DD$ @ %(% j'@@(%*! *! $!4(%< %Xm!fXl* $(%$($!$!v@ %b  x%F*2E$$($$!$ $I@ %%*Jf(% 'K@(%%lNL$!? @ %fh(% 8%h@u@(%${@ %Y(%')If 'J@(%%K)KL@ %%Mfh(% 'Nh%@(%@SO$Y@ %f(% 8% @(%f@ %(% '@(%@ %(% '@(%@8(A &)@$A&)7&)-!  0% H<)!) DT.$b D`$DDFD $@ $D F! $- 'x</!/@D@%D$% D4$' .tt$D4 $ % .tt$b D@$DD@FBD$@$ DF D@%D$%<%hO$ )P Ž ǧǦF&"   `< %M~$ $< ǫǪF4P2E dzDzF2  *@ $A<! X v  x!k ǩǨF(2 b )P#X  dzDzF2 O hI A@p''?"P: @ lh* b  ǩǨp%F(0<E$ 8x(O@H* b ǫǪ P%F0P<E$   8xX* @ p*9b dzDz x%F2 >E$ 8x(Xٮ@)P*9J b  ǩǨX%F&@>E$   8x(L9 @x&-b ǫǪ %F0P2E$ 8x,Y@ *X& X+ b dzDz `%F$2E$   8xh+ u$o)P&i lh%c D ǧǦx%F402E$D0+0+KD ǩǨ%F4@2E$D0+0+3< %)I$'K@ % ;xx"% :@ %<$@ % 9'x$s<$ƾ <$ƾ$l< h!<<'|$8$@ % 9$Tǵ0Ǵ4<@DHLP'P'Я$#8(#%& @$ 8X' $ $A$  8X'$  '0'$PDH$$<F$N%@ @%8%P$T 'DT@@%`%L$ %P<$L0%' 9$%$'P' T'8@@%@$8$A DOǥ@58!DǤDF !D<'l$8H'\ ;44'`%' T'8@@%@ $8D F!$Aǩ@ǨD<%ヤ$H'\ ;44'`%' T'8@@%@$8x+$Aǥ@ǤDD0D8%F& 2E$<'9$H'\ ;44'`%''8 T@#4@$d8 8X'H$A Hd@D 8X'HH'\<I'nx'\HH` % 9$H'\  ; %4''ȯ :$ $d :44$db@n`'8`%'Я0 ;0 ;'0'(%,d 8P %@ d!9d 8PX !$d* 8@+ 8% % :HD ;@ % ;HDd ; ! X*X! h!$ a$;a % @%%,('`'Я<&ߠ%bp!1 b$c!(1  @` % $` % a(%J@%$C'0' !$lp+ lh$ 84 !  <<84+ $X+$F+`8! !$ |<<@8! lp$D$+   !l$D@!d`8!l$ $  `%l `l ! 8P@@@0!0!$ȃp3)P!l  ! !'D0! p$@L|@@  !$L 'h'$쯦X!h. olnh$ دԯ` !  菨܏؏ԏ+ $X+$G+` ! ` !$ |菨܏@ ! elyp$"+ ` ! Я菫el$!cd` !bl$ $ n`%o` %I x<!A*  hxhyl$̯,` !  菦̏,+ $!($!L+$!($!G+`(!` ! |菪@(!eh%p%1` !@0! L菫 (A  @@!` !@0! 贯菫(A`0! 8!  %)$ $  !$x/ <8!8` ellph!+ ,@0! L` !菩,nl$!x$!mxl` !@0! `(!d%L hC<-!A* \hnhol 0@$$$!H$,` !  菥,+ !X+!G+`(! ,` ! (! |菦,@(!e`%%3-` ! L菫(A  @@!` ! 贯菫)`0! 8!  %)$ $  !$n- p<.!.| Ԭelxp 0@`! + , L` !,$yl$p$.x!ol` ! `(!< !A* hlhml 0$$$!H$T,PdX` !  菥T,PdX+ !Y+!G+`(! ,` ! (! |菦,@(!ep%x%1` ! L菫l(A  @@!` ! 贯菫b)`0! 8!  %)$ $  !$l- D `<,!, (elyp 0p!.+ , L` !,$ol$`$h!ml` ! `(! $A$A$ ALb|@@ ` !$''X8!<* lhf$ |x !  |x+ x$X(+$F(+! !$ |@! lp$D$+   !l$D@(!d!l$ $ ji ` !%l `'m0!n8!o xy pi@ |@@  !$@`t$A $A$ A0F$llp$e$ : !@Eԏl & !>@$Xx@pl$E$ : !@-"ԏl% & !&$KPp`l$E$ : !@ԏl  !`HP$$RI !'H Jl"@ l 6 !|@@  !$ pIP!@ȓ̏Џ9|@@  !!<8''ȯ 40!(,$N1DXYhHl(  @ !@ ! (!3BhIlBl"#!*@!$$j$exD`(! GX0!@"# !b!xT @ !U *  C @ !V @ ! 'Jd4 $(,0'8' $$!N@ ! $ @ !CX`A`!O1BX9D<@4f L'8A @ !8(a  `!BX'(a $A@!$!C@ !`0!8@ ! '8*!  '8 @ ! (!@ ! \(!&1*!  & BX$ '@'( $,<@!6f$D(! L'DA @ !D(A  @!`$ NPX@ ! $ @ !OX&!*! 'H$! !$!C@ 0!@ ! 'H @ ! (!@ ! \(!&1 & YP , $('H'Я!,( $.!1.!,x$@(! =D0!P%$$e@#B!x F !x@$ x  !x  !$@(! =D0!P, $('0'!$ !1K! I28Ȁ<@!`'(880,4x',$ *!Q5$$e@0"#b#a 84c`!p#!840,0!,x2 F !x@$ x  !x3  !', $Q$ '@',(!4!0 $28x<!`3 {( ! 0!p !' 0!j#h)l!##P!T!@!@^@!#*(!0! @!!` #l+h$r`!h(# !#* @!!`  #h'!C쏯$!X !(##* @!!` '(!'P!JC$x$ 'h@b#B!`!x$eA  !$jA *  C  !$A  !`#h'#l+d4 $(,0''诿!e$n * x(o$h$!< <<$p$t 8< i$e$!''د$ 1H!"\!"\<Ax$0%+ @!'`<0!+ <<$$$t 8($(<0!+ &\!'('(40,!$ `dn܎u`1!!x` ! $ ` !` !@(! $ B@E$AH2(u\` ! B@(!`@d C`` ! R`(!y$CC` !&E 0o$C+ ` !&E 0d@K`` ! Rl(#[$` !&E 0 ` !S!!` ! B@(!U?@!B$M-  ! h<-!-B :!$-A$UA$\A!N $/)!'!p0@` !@(!&@ 'D@! D` ! @(!k!` ! \@(!c4 $(,0'X'Я! $! .! $ !@ !'0 0!0# $ '0'诿! 6('Ƅ'د!,@@!nƄ :$d@ @!$ x ! ֯$$`,$ !3(H P!K$e` 0!$@ T@CP XT% XƄnƄ'(!!'诿@!8!1H!  ! B(!  3P+0c$k-a! 4 X<+!+`   $ ( , 0 84    $ (,084     $(, 0 8 Р4   $ ( , @00c+`$80c+`$<4 +%$$ L     {$     $(c,   Z T    $ (<,6  -   $      $ ,    $(0 ,    $(4Ӭ0    Ǭ             $  v    j $a $a$ a8X !!!$X $xY $ByJ $cjK kD   "$ & ( * ,#.  $ ( ,  !(! 0!$' * x<o!c<$c``!@!<$c`!'௤ x  <n<x$$t@8! 8 <oX<f`g\$,$t 8x$ <<$x 8$t 7p$' '($!, @h!E! !' ` $ <'`$ $ !' .'@h<$'` 8' `<<<'`$ $$$ . !@hF 8'`F, '@ 8X'<' `$ $ !'@ .'0   8 ;' ` `@h<$ 8' `L- ,<<<'`$ $($$ . !@hF 8'`8G'` 8X'<' `$ $@ !'` .'ȏ@h' 8' `@h C'ԒB,A F `04@ E$  !&@ ' ` ` ` J 8' `' 8XK8#' ` ;'<<'`$ $L$ ! .' ``]@hF 8'`@h C'S$A$A$A$A$ A$ A $ A $A$A$A5$A<<'`$ $X$ ! .'$A<<'`$ $d$ ! .' <<<'`$ $|$p$ . !@hF 8'`@h C'<<<'`$ $$$ . !@hF 8'`@h C'<<<'`$ $$$ . !@h&` 8'`@h C'O$!$, $('@`'诿< D$t@! 7p$''Я 0 B44(ƀ$0, -. ' ''0'诿5܏|  ''诿!n+ d ; !$ :@be`b'`!`%! !0!  !H!@` !!%)** %k $* % $BC* $P!'诿 ;'Ƅ'௱@@!0 ; !!!' Ƅ'௿$$ L䯤 $x! 8P' ',@!`'P'L'H'D'@  !'X 'T`@!!XkK`!$BD* $cP!,'`'Я(,!8! $0! L''0'!` 8! $(,' L0!!'0'(!,|* lhf$ HD !  LLHD+ x$X(+$F(+! !$ |LL@! lp$D$+   !l$D@(!d!l$ $ ji| !k `'T% `0! p8!@ |@@  !:!`d @@(!$ : !bd@ 0 ! 6(!|@@  !!e  !`\9dj|@@  !$,('x'4L!X@!'H'D '<$'@('L$$),0! 8!X@g!H$) <- D$  L ; !R!L3)iLKkLmL o LyL*jLllLnL x L)$i$LK(k(L,m,L0o0L4y4L*8j8L ;$4'P'4T'L'H '@$'D('T$ $#,$# 8!@\!L$#a @- H$  T ; !F!$ L$$@9@!TXT($ I@TKKT M TOTYT ITKK@-  T N @ T ;PP`!4'X'诿 `$*''诿 `$(''xDtx'd'` 'X$'\('t$<$&,8! $&@`!dt$&a X, `$  t ; !J!$( !XX$$ Lpp@8!@@!t ; !x|@@ (!X!$Bo$cx$yhijXK+ Xt ;$D'x'ȯ@D$" x'(@5!,$0$ ( ;%!4 (8@!  ' 4'(' '$@ ( ; ! @$D$'8'4<!X'L'H 'D$'@('<$$!,$D 8!X@` !L$!aH$ D <o< ; $`< ; !!4'P'<pL'\'X 'T$'P('L$ $,$C 8!@\!\$aQX$ML 8P$M@!$D$ :dpd@L ;>!L ;ddTn$cLd ! 8P$d$X$D$ :dpd@  ;p L ;!L(! ;$L ;$L  ; !!<'h'4X<'L'H 'D$'@('<$ $,$' 8!X@`!L$a H$<$ m< ; !X`!4'P'4X<'L'H 'D$'@('<$ $,$% 8!X@`!L$a H$<$ m< ; !X`!4'P(! $$($'+ , 0!$ ! $ :@0!  ! 0#!x!`! ''诿$cX@@(!$ : !@ !@!@@(!$ ;@!$c@ !$''@!H!P!!$A<'pxX!gY  %&%b $$$b$f@DH$ `@DH@@8!0@DH%$ `0@DH@ D!l  ! 0! 1"#@ I!$$$F$$$$$$$$$l* 0 0@ !g x! $c'@'诿(!0!!$@p@0!b$@$c ''n* ` ! @!! $c!' * !!"'Я$8048< ! ;8@ ;@4< !@!48@4<<44  !$ :@6@!04`(! L,,!< <@ !$ :,,@@(!` ;` !8<, L(,((!4<4<`@! !@8$'0'hHX\PTL@D8<`H!D 9'D@@!!!ƀ ذ !|  !$ L$@@!!'0'D'H !'`'\ 'XA ; !!8` @@4<`! @!\' 8X'L 8P'862FH'0G `@@!PQRS!!!!H ; !$ $lt$Btx$ vz| !'t 0! v`8!  ! !'l $n,  < &t<&t<$ ! 8$ p<$ ! 80!r@@!@(!$ : !d@@! ; !! ! (! @0!l$<`'X$T ! 8'Pm !$ M8!'`$$ M8! ; !d ;!n<Gp<G,$`L-$Ƃx.' /<G8į9 $c($@)' *0+4,8-<.įįt$#C@CĬ@ĬC&@ȬC̬@$B'ef$$$'EFEĬFĬE&FȬE̬F$B Mԯ$xȯ$O(h̖#$c``(!$ : !@d  !v!0&1  (! ;0!$!& $P0#d$ L0 !@d@@(!$ : !@Dd  !R!@!!D*#!J+&K,@L @&1* $c@!A!@@(!$ : !@d  !(!!!3 !^8&1(X9Y0(H4)I8*JL+K ,L-M.N/O@8@(X<9YD(HH)I$*@JB@!A#@@(!$ : !@B d  !!K!`G!L -! .&1@5@``(!$ : !@d  !! !"!%!EB(9$Y(&1H)$c I*J +K,@L * N&* & &* k&P|<F$ '9|xH,`\X'0d`$ :h@ld  !t!hT%lpPX$ L$@̏d  !b!d ;X*    !P!@!! !׀!8$ 4' @, ! (!8!&* &Pƈ  !ƌ< ƌx5J%$ '' ''|'x,($ !$ 8!@$!$xx ;!\8<@DHLPTX''௤ $  $ ;' '8<04(!, $`E!>!! `+!@$!s!DX!!Y0@!  I&1)* & D ; &* &s ;` !  &* &P ;` !D@!`!Dh!  @&1.* &D ; ; ;h ; ; ;  ;  !@@!8 ; ; !@  ; !< $(,048'@'Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ $ 4 `|%@ `@  !'0'ȯ(40!,$ !WV !$ L$@BW)$U%U!!!p&D Dx!H1 $H!* Kc`!@@!&&s ; !!4 $(,0'8t'௿8!(!pp!CnH`!$$B $ : @@!@p:!$B@@(!$  ! ;p @)!@@!p$ : tpx !@@ !! $$ $t  $$A t$ ;t!!' 'ȏx$<@`Dn`0! Z@!x@0!5$ $B* , !  (@,$A$$$ :,,@@!$<!x@yDh<@ P%K`!($ !y H!#$'8x'௿`,n ` !$ Z(@!$(x@ !$x!'(H$ Pj`!`m no,!/c `$' 'ȯ0,4($x !!`n`! Z@!x@!`,$yx!'(i$4P!P$!  m !%n  @o!1Q ; ! !! !4 $(,0'8'Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ $ 4 `|%@ `@  !'0xx!y!!!"xx!y!(xx!y!,xx!y!8xx!y!4$Xxx!y! xx!y!xx!y!xx!y!xx!y!$xx!y!("Lxx!y!$xx!y!04<80`$B\xx!y!!!840$,( $(@<HDL(!FC !$* $cP$'诿D ''诿H ''诿L ''؏8$P $'('诿T ''Я!+ lh$ $( !  ($ + $X+$G+`(! !$ |((@(! lp$D$+   !l$D@!d`(!l$$  `%K `'0'8!<\`d* lh$ HD !  LLHD+ $ X+$ F+`(! !$ |LL@(! lp$D $+   !l$D @!d`(!l|$ $  `%l `\` dhlptx@LP , ! PT0  !|@@  !<T8'X'0P!'h'lh0$BY0`$BL0 $BN0$BX0  $BK0@$BM0$BO0 $BY0`0$BL0$$BN0($BX0 ,$BK0 4$BM0@8$BO'hX##X!H}LhMl0$$$!H$L H\P@ !  菥L H\P+ !n+!g+@(!@ ! (! | @(!'h%%3+` L ![(A  @@! 'hS)'h 8!  %)$ $  !$L- 5 `<,!, p ElMp0p!+  'h L菦 $Xl$!X$ x!Ol@ ! 'h''hP!IX! ;'|$%$ OlNh$hdxl@ !  lhdx$+ $ x+$ f+@0!#xl@ !$ |xl@0!& ElYp$ #+ x@ ! ЯElx$ !Bd@0!Cl$ $ N`1k%O`1y '|1m%1o%1y  % 1m%1o %1y@ % '| #0O!I %YhLl0$$$,@$L HP\@ !  L HP\$+ !m+!g+@(! # @ !(! | @(!'|x%%3  ! L`(A  @@!'| 贯V)'| 8!  %)$ $  !$L- 8 `<,!,  ElOp0!+  '| L $Yl$`$,h!Ml@ !'| B|@@ @ !''Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ $ 4 `|%@ `@  !'0'ȯ !$<@D* lhf$ ,( !  00,(+ x$X +$F +! !$ |00@! lp$E%+   !l$E@ !d!l$ $ ji `$%l `H!) (a X+!L $c(a $BM(a %5C* p.! $x$P*X!e8'$ |' 81 $ $m!`!p.!'0'௿$( T @!'( ' 'Я !,($N! T@ !@!!TCt* B@!2@ ! (! 0!S  !B&* C&t* !, $('0'௿$8! n ` ! T @! 4$ ' 'ȯ40(,! $  !@!@"!. T !@z! @V* @!44/! !!% 0!U 5R2(&* &sv*  䎓`!a#v* ?"44~@6! !3P!E 0!R+l$ $<a hxo%8U9h$  $<a H*`,p%."&* &sv* 0  ! (!$4 $(,0'8'诿(!$A  ; @ d  ` !''د(#$c`0!'$ 0E(@!$  $'(I,A ,[ % ,a ,{ ', , % , , %K, , % , , %'TH!.0OP ! THOPH@!/T58"+ *E+ X$`#h#,(apx @!!Y $c(a $BJ@(a +h$%$c.`$(a 4+ 4+ 4 0XjX!f"0@0@+`$a  X ! |'4MXI084$a44@ !'8 |'44X/$a$<@ !'8'4 |H$<@H@48 !`(!'8 |'44XX<4!!$'H'!@0NO 0Ff* `0!D L(!p!B@0`,@+$A&4+ 4 + 4 44444+ 4+ 44;!4$ $ $-$A00c00c0$,a@ ,a $ a0c0c$2a!,a3 ,a8 $c 0c$8a$$/a$$' 'Я$48<!d e4f0'(0 ',0<@ !(8d (f04 $'0'XX4\`d T !@_X$ :T@#@8!l@@ !$ :PP@ld`` !$8 :PP8@`3 ;PP ;PP ; !X'ďTlhP L8Pl8` L`0!P\(! dX 4'X'௿  ; ; ; !  !' x#%`@!Hi!b+  X# ` $< h!0B%+ !'Я(!, $!47!! !!% 0D1e$c`h!I$c`$BJ`e  $<a $ &RX*&1`pnx% ̮3(, $('0'诿 $ ''诿X@@! ,@!'`!'诿X@@! ,$@!'`!'804(, $<!!!D!$$$`qQP E&0(!@ ! 0!@#!D'`' % `"@bST"@BP@TƄ$9ƄHX% $IX !1 @ ! ,(!J@@ ! (! @ !&$!< $(,048'@'௿$P  P!`!$'`' % b@PTƄyƄX% X' '!d* lh$ 48 !  0840+ $X+$G+`@! !$ |88@@! lp$D$+   !l$D@!d`@!l$ +$   ` !%l `'@0! p$dP ƄTPƄPTX'`'8!<  *$%$ lh$ TP !  XXTP$+ $X+$F+`@!" !$ |XX@@!( lp$D$+   !l$D@!d`@!l$ &$    !  `'`%`0! p$@ |@@  !%!hlYprtvYx|@@  !a<8''8!<* lhf$ PL !  TTPL+ x$X +$F +! !$ |TT@! lp$E%+   !l$E@ !d!l$ $ ji ` !%l `'`m0!n$ox y i j pk@a|a@ !@ XX<8'`!'(!,tx|* lhf$ @< !  DD@<+ x$X +$F +! !$ |DD@! lp$E%+   !l$E@ !d!l$ $ ji ` !%l `t'Pmx0!n|$o x py@Q|Q@ !@ HH,('p`!'Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ $ 4 `|%@ `@  !'0'Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ $ 4 `|%@ `@  !'0Ƅ'௿$ !$d : @Ƅ@Ƅ!ƄyP@P!Y$% `% A%J A AkTbP`bTlX%mX' 'ȯ !$<@D* lhf$ ,( !  00,(+ x$X +$F +! !$ |00@! lp$E%+   !l$E@ !d!l$ $ ji `%l `<m@nDo |@@  !$ '8'(!,DHL* lhf$ 40 !  8840+ x$X +$F +! !$ |88@! lp$E%+   !l$E@ !d!l$ $ ji `%l `DmHn LoPxTy|@@  !,('@'ȯ !$<@+ lhf$ ,( !  00,(+ x$ X +$ F +! !$ |00@! lp$E %+   !l$E @ !d!l$$ ih `%K `<l@m|@@  !$ '8'ȯ !$<@+ lhf$ ,( !  00,(+ x$X +$F +! !$ |00@! lp$E%+   !l$E@ !d!l$$ ih `$ %K `$ kj `% `ToXn\y `hdipjtkhllm|@@  !<8'P'Я!4* lh$ ($ !  ($ + $X+$H+` ! !$ |((@ ! lp$E%+   !l$E@!d` !l$ 6$ 4 `|%@ `@  !'0 P!,I )@! 8!k+ \+ WDQ$,x Ȁ+#x#xȀp#!8!D @<:8! *+8! 30fE+ 0 + +F+ &D $,Kx#%p#Ȁ&#Ȁxx#xp! xx#x!p#8! 8! (!.HL.@ (! + M+ HDB$, Ȁ+# #Ȁx#p!!X5Y 1N-+!' + " + D$, Ȁ xx#-#Ȁx#p!!Y ON!@OX!`%AAaaXXxxAA a4'@@!8$'$ AD0!@ 8P'$A  ; A !"$<$ '' ='$A5' M$_@'$P' 8x(!@' 8x(!@' 8x(!@ !'&!H&' 8x(!@' 8x(!@<$°' ='$A$<$' ='$A !<$' ='$A!' M$_@'$P' 8x(!@y ` ;` ! A !$2&@,A   $!t!e@@ !$ :@ @ ; A !$ 0!@B@!  !A  ; ! A !t$&&"S` $a<A h&z&"@!2* !@@!  !A  ; ! A !F$&"&1'$ AD0!@   ; ! A !0$8! ௹@  ; ! A !$̏Э"Vȏ`m@N ; ! A !!\@DHLPTX''`!<$`0! @@(!0! 8!@@0!&!HP\d DL$X$j$l$T$$  X@`hp z'HD (!@<''H !$* lh$  !  + $ x+$ f+@0! !$ |@0! lp$ #+   !l$ !d@0!l$ -$  `%` ! 8P@P!P!, ! %I X1l,h!~hl$|x4 !  |x4+ $!($!x+$!($!g+@(! ! |@(!X%j%3, L@0![ (A  @@! @0!S(A0! 8!  %)$ $  !$M- 5 h<-!-!0 lpx!+ @0! L44l$!X$ !l ! @0! ` !% ` ܼ'`%@ `$A !'<0! p8!|@@  !$ ''!$ 0! (@ !@(!@ &0& /l.h$ 0 !  ,0,+ $X+$F+`(! ! |$@(! "l9p$D$+   !"l$D@!#d`(!$l$.$ J+`%l,`D  DD ;D( ; ;@ !"|@@  !$ '@'h(!, $P$ OlNh#$@ !  @@+ 8$X(+$C(+!@ ! |$@! BlYp$D$+  @ !Bl$D@(!Ed!Dl$/$ ih@ !jK`'T%lL`$ p8!@$ :$P@@!$@M'\N|O ~'lXYHI JKHLLA,A/N0N3 A4A7A8A;Xd(# 뜯<$ߠ$@4 H<y$ߠ$ *@X!b$c@` !G`$h!1b$c@ G$!,1@ d(# 뜯@ H't " !' 8x@ <H%ιx<Ht'x% % 8x'@<H' t'x<H'9 t'x < H% 'x< Ht% %t't t<H%  <H'9x8ȏ0'l$ Zh$ @ȏ@$F$ ! :ȏ@ BD ;'lďhM!̯ !$`(!` A @ !%`ȏAqp$$ Mpp$ M$  8P !@0!0!$8!d 8P\d\ @(!Xd ! 8P\Xd\@!$h!p!!$B@@ !0!$ : !@5  0!'' '$<$ 8X/ ; ! ; ! ; !p)p  =< ! ; ; ! ; !  ; !$D''Hį,(! $<$H$'J 8X'( 8P'J$S$H$ M0!A@!$@ !'H N`0!Ax =<@ ! x$ N$ !@&1@!, $(''(0!,4!!x'x Z$'x$Ap$ <x!ߡ1 N, !@!$$a O !@@!f$Y$!`$h'hdi$$ L$hd&Jpdfd$0! M@ !A@!F$$ $ H@ !$$ PH'H@ !'d N$Ax =<@ !$ x*$ N$ !&1'hM$ N OX$ :$@ b$e'h L$ @@!4(,0'x'8L`<HLPT  !@4X\HLPT 툯@D$ \$A<<x$ 8$d菊Ɣ $@ $ 菍Ɣl D@ƔD  ;$<8'H'诿 =<'!!$!(!$$cb$!'x$,!( 'l PP$'P PP$$B'qCx!y$ 0H P*X%kB'aC h!o0X @%yȎD'l'P8! =$$A@!xS @ ! 'l@2D<@4f'H L'LA @ !H(A  @!$ *! $! !$!C@ 0!@ ! 'L  `@ ! (!@ ! \(!&1 & 'P@, $('' ,!($'< PP$$$"'XqCx!y$ 0H P*X%k$'<0!8! =$$R@!x  !, $('X'l!蔨?P!\X !$ h\Xh\ !@(!0! X\<10!4X !'T XX l ! 0! XX<1+ `0!l4,( ! 'T ! $+$ ,('0$1x<JH0!4$B$c'TXF$B$c l1+ `<I0!Y4$B$c'TMF$c'( `0!'`'(0,!$4!!!@/ *!  '@'T 8X 0!p<8!P<$H` !'@ . !'X 8X 0!p4@` ! (!&8!@ 4 $(,0'`'߸4 \ H L P> T\ !< !V$T$\  L P'< 8X'`<' <$l'< !' D @ @  T @ 8P@ !$K < X @ \ ; \ <+  X \!4' H'4HD@<<@!X!5B@'L'H 'D'@'<,($`0! 8!X@L` <$ L HD !4'P'诿 x$'''诿 x$%''诿 x$$''LPX!nj $o$d!@L$P\ b$@ @!L$$c`$B@@ !$@, :H@,H@@@!?!%I  !$@D$, :H@D$,H@@(! ; !&!df ,$D@ L88,$@Dh! !! %CNx!$E$$c`$BL$(P'H'!` d ; ;` !'!@ $$b$!!@$$'<04(8, $000 "`H@@!L! ! I$@D! ! >4'p@@!<!V4 " !@3@!Cc 'N#H P0!@@ @ B P P@0!@ @ "X P 0!@  ! A !!< $(,048'@'!`#d ;d  ;d ;d ; ;` !''诿 @(!'!|<H%||`!||`!'௱! "@@  !$ ;0 ; !!' ' !$lp+ lh$ 8< !  4<84h+ $bX0+$bH0+`@! !$ |<<@@! lp$C#+   !l$C@0!d@!l$ u$   ` !%l `'D0! p8!H !'h 0E` p`!M* @0!pl L'h|@@  !E$ 'h`!'(!,|l+ lhf$ @< !  DD@<+ x$X(+$F(+! !$ |DD@! lp$D$+   !l$D@(!d!l$ e$ ji ` !%l `'Lm0!8! pn@ |@@  !-!P``8!@@ !(!$ ! :pp@ l ! 6(|@@  !!l ! 0M|@@  !l,('x'诿8!@!$N-! 1p<.!.!   $ ( , 084    $ (,084      $(,0 8 4̡    $( , @ 0 85<7) 4    $% L$  $y     $(,a   X  R   $ ( ,: 4+   "     $   ,  $ ( 0   ,  $ ( 4 0ѡ   ť             $    t  h $  A $A$ A8V !!!$o$O x$BX y$cY iI B    "$&(* , .!   $(,   (! 0!$'<$B $Nx!$'Я$ (@D!,!!!t `!$nn !@(!x0! L$b@ $P !@(! L0!&*3! T!, $('0$$a$`!8#@#@!%I$   k$Bp!!!,h!@ @P!$%J$$@%) !!(!$$a%I`!a#`!8#@+@#$ $  $Bp#x!!8!mP!NnOo@ @!$$$c$$`%) !!(!$$a$`!8#@#@E%I$ $  +)k$Bp!!`#k0p!!k#`0p!!`!-p!@@P!$$$%J$$@%) !!(!$$a$`!8#@#@G%I$ $  +)k$Bp!!`#k0p!!k#`0p!!`!-p!@@P!$$$$$%J$$@%) !!(!P!H!8#f#%$<$  !N$x!%J%)8$BGP!A#H!H!P!8#f#%$ !&(01yX%$%)K%J$B'H!ACP!P!H!8#f#%$<$  !N$x!%J%)8$BGP!A#H!$$a$`!8#@#@,%I< % $  k$Bp!h!!p!h!!@@P!$x!%J$h!$@%) !!(!$$a$`!8#@#@\%I< % $ $  75k$Bp!p!!`x#k 0!.!x!8kp#` 0!!p!`!.!x!8@@P!$x!%J$p!$$!.$!@頹%) !!(!$$a$`!8#@#@]%I< % $ $  75k$Bp!p!!`x#k 0!.!x!8kp#` 0!!p!`!.!x!8@@P!$x!$$p!%J$!.$$!$@蠹%) !!(!'Dh!@!4H!%8$#H#` H$$ $ !X8X$Bx!@'TTP$ PNx؍$p%䯯P3x!$ $$!``!$!$ X!$ 4$ A $ $A!!`P!L<8!$0$N !$ Ȁxx#,# pp#y/!q! x/!p!x/!<p! L$ ! $ L$@!!``!F!$IX!$  p! x/!<p!`(bx/!<H'9H!C $$T $$!TO!+ hl$/ !  ԏg+ P$($e!X`+P$($e!G`+`(! ! |ԏ@(!%p%x%1 ! L 0!5(A  @@! ! 0!)(A 0! 8!  %)$ $  `!%-  x</!/" l䍯p!+  !0! LPl$$!ۭl !  (!P$p$䍹 lpx!+ -䯨 ! ꯭ԏ@̍@Y Yl%譸l`%` !X$TL(̍$T`8!X'.L쏹%xx/p$F=쏮0!.H#T$8!xddl($/($\௨ ! ꯭\ԏ@4h@N Nl'譹l`%G``!$ \ ! :\ԏh@ȍ@X Xl'/譯l`%$`$ $ $$!``!$!$X!$ $ $ $!!`P!0LX8!$X !$ Ȁ?# # pp#x!q! Ȁx!p!Ȁx!<p! @(!č$TT$caLX#(/ԯ\įЯ ! Џԏ܏d\$c9H!a(!$T0$ $ $$!``!$!$$X!$ 4$ A$ $A$!`P!<$8!$$X !$ Ȁxx#,#y  #/p!! x/p!!x/p!<N!B $ $ $$!``!X$!$X$!X!$  xp! Ȁx!<hd@!`菧H!܏T$c` į௨ԏďЏ쯣 !@ Џԏ܏؏$c8H!`(! ! ;l!l̏  !D''`D`!X!n, $Nh!x%$Opï%$!'.'$%Lȃ3/p!i(c, yx/p!x!a=3.8I@@ !$ :@@O Ol'譹l`%i`i( 8! ֯0bbn,$o(x.x!+ zhl$. pl !  plg+ L$($e!O +L$($e!G +`(! | !@(!%%3. L[(A  @@! S(A0! 8!  %)$ $   !$- 5x</!/" lp!+ LLl$x$/!l  ! ; !L$!x$ lp!+ i(- ! ꯭@ ! ;@O Ol%譹l`'g`i(0bbc,$a  8! <$ a 8! ,$a 8! ܯ$a 8!   8! l!l  ! ; !D''D\`@! P! 2$%$ lh$LHXP !  dPLHXd$+ $X+$F+`(! "XP !$ |dXPd@(!% lp$D$+ X ! ЯdXdl$D@!d`(!l$ H$  `$%`\`ptx |O$X Y$!K $a lh !@0!  lh !@0! ^D'X'XTHDPL@<p|xt\!!!!8 "t<4!A+ <(C$$aN $O94"8!'- @$p!x!$Xh'%-p$x  &nx'@!!'- $ $x+  $( !(!0!@8! *,[-! *d $<a @!@$ $(,tx !(!0!@8! |t|x0H#PP!`!3(,tx|` $a<! $$ $ !(!0!@8!ph#@!  xt|!#bpX!\8<@DHLPTX'`'`l\pthdX $PT!P!`!H!t!!H!!bp!N* T#bx!O* ^H# d$$x $V8y$C@e,v BD$c` !YUV $ca$Bf$ L0m$& X'px!% `$ h@@ !$ :@m '%&҈!` !(!  0!'(!@0!  @8!&&RA8  (! (,' $|@@  ! ;) @ !  $(,`8!@ ! |@@ tPTX\`dhlp'@D$B$B@ nb $B@$c8@D$B$B@ nb$B@$c!'$ H@!0D4!C$By$P$1`! X%L+ K5MC$BM$Bp!N+ C*CO$B!Y+C O CXCCJ$BX$BCJ$BX!K+ $$$$$ 0 t !' < p%Jʐ08!E!< %ʜ$ < $@!0c%kʜ#H!/F* $ 0!B!bp!, $x$0%$`%p%b! 0#$3,L*$0c %Fp!fx!x$0c`$p%0#'Я$8<@!!$ (4$X0 L$4<0(@@0!f!HJLG N0O4X<` Yk K0lL4mM8@8@4@0$ 8 ! v,,<H@H!@TP 8$D@*$* @!"X!%l` hpx( D!!'+@!c` `h p((,<,  !,!$'0'诿(!`` ! ;< ; ; !'$' !$.$$ `!NnX!8(.x'!/d'd@!h! $< 'xp! 2@ x%$c$Ho$cy$m$n$c$c$%$$c'&F8X /l'd(! l'9h! $< p!d0O3-d%,$$% Ed0$$H!@!yÎ%(e9'h!.'``!x! $< ph!!2 n$B$c$Px$co$y$m$c$c$$B$$cP&F.N8'lpDT'`(! TDpl$ /-!-% $<! p!`0Od3-@ x%d9%($$*p.H! %,n$b-(.,m8`0,'`&@!x!h 8!!$!2@ o%$c$Hn$cm$y$x$c$c$%$$c/O ',l'`(! $l!'kCMr%XN8%z%d%,$ d1d0cd%,d<$, "'%,$$dd`!<x!ʨd/$$ 'h'诿 $8!,$($@H!'P!CX< `!ʨl$0c `! H  (!''诿$$$8!o(!P0BH*(!$ K0c$ L0cp!$$! `! H  (!'',<804(! $n$$0c'`!  |b$$`!x(mip! Îj|'|@!YX!  $!< i xPj! 2$ Y%$B$cyL$BlM$cmN$cnO$B$B$c%$c$Boifx k'| (! 8! iy'Y`!  $!< 0!'|@(! fmng'| (! x(mip! Îj'|@!XK!  $!< xP*! 2% ! K%$B$ckL$BlM$cmN$cnO$B$B$c%$c$Bope d(x$Jq!*@^xi! `Îk'||@!hmp!)  $!<! PLXh! !2$ O%$B$coX$BxY$cyJ$cjL$B$B$c%$c$Blfnkg'| (! oy!'  $!< 0!'|@(! fjlg'| (! k(ji*`! XÎo'|@!h!  $!< pxh! !2$ Y%$B$cyJ$BjL$clN$cnK$B$B$c%$c$BkB@!  |xd(m$&*x# =$j(*o,n|p,'|&@!`X!h y!! !$! 2$ J%$B$cjN$BnL$clX$cxO$B$B$c%$c$Bop,@!m '| (!0!8! llp,'p0!'|l(0 yl g,l'| (! $ln(Nk,x'|` x!P &!2% ! N%$B$cnX$BxL$clM$cmK$B$B$c%$c$Bk<$8 "'< $(,048'$'诿 $,$ ($@H!%P!G $L $` ''诿$$ .+@!o&(!X0BPK(!#$ L0c$ M0c0 !X%Y``'E!K1mp$N$ $ L $ (!''0(8<4,!! $!!$X L$@@!!PQ@S $N K OXY H ,I,$aJ$L,C ` !hp!% @H(C #H!%*` !D Xd` h¬M(<  !( $$$ L(!@ ; !,!>#s+ `!#Q+ @!Ӹ!+ !ј!+ !^#H !(! @0!L !(# 0!@ @8!&&RW!< $(,048'@'($8<04, L!!$c$!n<$D' "`(!#!!L#L!x#U* @!yL(#W* @!w* `!* !L2!H !(!@ @0!kL` !(! 0!` @8!&&RW< $(,048'@$'د !$!`z.$$N(/(8"!@n2C` Y& @'Hp$BcIKM P'OJ$B``'L$Bp'N$B&'X$BO% E"#!`G"@!9H !(! @0!(L !(!@0! S8!"&* #&RC* *$"#!`#"@!)H !(! @0!*L !(!@0!@ S8!"&* #&RC* <$P "'$ '( <H<H%%$@ D,$!<H< H%%)謈HL$$A l< H<H% %xHL<H<H%' HL<H<H'9%PT'௤ 8!! <<$t$\ 8 7p$' '( $,$!!$:$$8<@` !$ M'8T@! #|P4$!, $('H'@D$@2$$D08$'0 M4$AƼ < <D@$ː$ P$!$'@'@D$@2$$D08$'0 M4$AƼ < <D@$˸$ P $0$A!>$'@',D@<8!40($PB$!@!< 6$N x!u&uƼm&u&uP  !@H@!B$bYI$P@*@!4q4E X!LD g hp!44Ƽ <&X$ !0!`8! PY 4H!1J TX!qL h!N pA Ƽ<$4$ P&FƼ P <&Y$d !0!`8! PB$b* D$(,048<@'H'د !$!( !$P ! @(!@@!`!Q* !$ '(, ,x!< X$@@H!#$ f P !K`!f$'Џ< @!$` `!OFB@$Ƽ<$̠ ! 0! P8! #$@$0 !(! 4($0(G Ƽ <$$ 0! P%($ ! (! 00$$! PjX!l ! ^(!$$BD* ! ^(! #$$'0'04!dh$$` `!NFB@$$L #hh$ 4 !$H #|Lh !  \(!$HP #|hL ^ !Ƽy<$ P$sdh  !$$^8! C!) Ph8$ 4\8\$H #|hL ^ !O dc`! Px! !( d +$(@E0! p! x!Ƽ <#!IF& \$4 ! P\h ! ^\\#!$<<* h ^ !Ƽ$ L<$$h ! P&L #Ƽ<d$ͤ$ P&$40'`'(,!lpt'8 =4 !tH*  ! PT(!tH<Bi$$AA*@!< bX@ $3( 0 #0@ #$Ƽ < G<X$ P ! #$!$Q!XXt$ P\` !$A @!Ƽ`<X$ P$!H ! PP(! Ƽt<$, !$ x P$t& x0!8! )$@Ƽ<$X P$t Pd !{!t<* !$ )(!@!`$ )$` b!t<* $ )$@!`Ƽ <$Έ P !t Pd !M!l Xt *B !@t Pd !=!$ Lp < \l ! lt  @Ƽ<$ P$t Pd !!<p ! @Ƽ<$ P$t Pd !!!y7(h,('h'HLH@D< 쯠x!$' 9d@d$ 5 dƼ`< 9$@@ !$ =,$@H!d l 8x@(!l@<p<ޭ 4!: $6Ƽ< <$$ ! P@8! z !$A !  $$A #|Ƽ|<$T P$| #!L #!c`@ ! =,$$A @!@ !$ =,$$A@! #|Ƽ|<$π$ P@0!| #!x%*x !$ M$ ! 4 (!$A #|Ƽ|`e<$Ϡ$ P@0!]' PP$ !' =D$<ޭ4! T (!@Ƽ < <$ !@8! P$ Ƽ <$ P !$,| #$@ #$Ƽ < G<$ P !$ |ȏ̯$$Q@(! P\t$A@! #|Ƽ|<$T P$NLƼ<$t P !t Pd !$⯸|YT 2L ) + !@X #|| T (!@t Pd ! ! ^ (!Ƽ< &<$м P ! =< !X@gt Pd !L .[Ƽ` < 菎䍆<$ !@8! P<$8 =,$A .Ƽ< <$L P !$ M$ )Ƽ < <$| P !d !  ʯt@@! #|x|%*`x =<& ;@(!   !A #|t| Pd !Md1lx Gh@ ! :$pPQ 8P@ ! :$Dp@ !@(! ; p !G@8!   0!$A #|p|gd ;p ;t Pd !LƼ < &<$Ѭ ! P@8!!x Gh@ ! =<  =< !| #!L@DH''௤  zt|$$ @ (H!"' 'P$< $ =,$A @!Ƽ<<$$ P$+$ !$ M$ ! Pl$ ! =4',@ Ƽ<$ P$ =< !$Ƽ <P:$P ! P:P! h$ 'P'$ ! #d@@!$ ! =4'4@N hBO!&<$҈ =,$A @!Ƽ<<$Ұ$Ҕ P$:$Y h<u4s !', Lܧ,@! =< !< dF$ T@@!Ƽ < F<$Ҽ P !  =< !  @ !! Ƽ`<F h$$ P8!$ !$ M$ !$ '`'Я!<ޭ!5κ$(!$ 1 $@ #$ l!$$0!$0%$$$ 0$$$( @ 1(!($@ #$ N!!$$ "P!D $cb`! g*p! ! @$cf*! $< <  pJp !@ @@"!,048<< kp !` @D! ! D$@ d !< p ! @H!$'0'Я048 #|<'4$4$(0$ #',0(* ', G'̏(<@(! G',', G'Џ M$@@!$ M4f 8P',', GX@0!( #'0'د(4('(0$%$X0$/,@! !<8!8"  #$$$'$b,A  #$$$G$b@,A'  #$$䯂$g$b,A  #$$$L x%$$q($$$q(%$$q8(79($'$q$*(AX$+($$q$m$b(<"<$$q/(1 $y'$b)0I*4J+8K #$$$$q$, 1 (!  ! , 0 4} 8<h$ w$t<hom< )h$ g$ d< kh`_]< h$ W$T<hOM$$b$A@ #$B$>$'$q$i'$p &$ Pt(! @/$*T@ &$T(! Pt @!$ !  $A@ ! #$$(! Pl @ $$g$l #$$!'( ` `Ƹ'诿8! $ `''4!<80l.Ɛ\/2T$  % (a $yD0 %B&$ $a0TB%:&$ \c0$l l0%@Ɣ$  Ƽ < '<$0 ! P 0! #$$D2  Ɣ$ @ Ƽ` < <$` ! P 0! #$"$&$ Ƹ0!@8! DD@(a tx/!b$$A~`$< y$Ɣ$  T1*@DDƐD@` T0"M%N"O%X"CY#* C0 < *+j-l ƔD@ O(1T3( < l& !$8! ¯< f@ ! (! 'As$T1l!DO(1T3( l< &+  !$8! ¯Q$Ɣ$  T1DƐD@ T0x "Y'(H"I%*J0k`< .< 8l)((+lj ƔD@ M(1T1 < l& !$8! ¯< *$*<048'h',40!($LNS8C * @&D 819Ɛd@ D8D1  BJ%KK81<  6< 6OYL8 Ɣd@ Di(D1*@81l L@ !$8! ¯n!&Ƹ|0x% 0!`(! `8!@* R81  < T6Ɛd@@ 81l BM%NBO%X83(< 6< 6 JILLN XL Ɣd@ h(1  81K`L@ !$8! ¯ Ƽ<$Ӑ P !$$N4$(,0'H'<HL@D804!(,$0OP& <lƐl  &D0%00 `!& 3%$&*X$K%Ƹ !@0! 8!@dh!V$$[N$. X@$Ɣ  P?lƐ@0P 0Q< Il  X'YH% IƔ@@ (1ll1 <  !$8! ¯ !(!0! 'AN$$AwI!Ɣ  P?lƐ@0P 0Q$ j$ <   I %*J K%lLƔ@ (1l3 <  !$8! ¯!L(,048<@DH''诿 @(!'(a 0!$#$a!0b* # !b #$#'(u1  #$:$$$x# !$$`$B+ $c@'0Y  @` 0N $& !''د !$,$$ (! 1$$@@! #$ +!.$%O8(3 $H@< )p ! @  !  (! !,  !A !  (!!!$ '('دƼ!$  % < <$Ӱ !0! 8! P@0Y  1 (!0H 1 (! < )p (!   ! 1 (!$ '('@@40DHL<@4O+ $ 1(!@@!Ɛ@ 8 4'( 8Ɣ@@ ?,b@@0k ,Ɛ@ 8 48%4@oDxHyT@ ௣88b LhP`i ,@,0` 0c 0l0Ɣ@ 40'@'p4<!80(,t z !t|$O t<  !  @0!DHt$  ! d \A$b@%$! ! ! r(!RjX@K`!2  ! =4'T@mb !$&* b@D<$ =,$A@! #|Ƽ@!~< &<$ P$v ! =4'T@ Pl !A #|@! =< !Ƽ`< &<$H P$XƼ@ b<t$Ԅ !`8! Pb8l<$ =,$A@! #|<@!m<uP4s !'L LܧLA@! #|@! =< !Ƽ(<f$ P$ Ƽ x<t$ !`8! P =< ! !$ M$ d `tyH@)P!P! d ` #@ !$<(,048''8<40!,($(! P|$ AU$B$!@P!$x!tC@ ! r (!$ P|@(!AB$70XB$1H@)P!SƼ`` ! =4'P@^@ ! r (!< <$\ ! P@8!$Ƽ <$ը !8! P&1"* &$<$(,048''@4(,@0!! zL$8@ (!  0!$8Ƽ< <L$ P !:$3 H@ P!RG8  !<u61s@hl <up!61s$@ ! L (!@ #|PƼ < 8<L$$ P$!4(,0'@'@,H!@HL zD$D8< @D  0!$D8Ƽ < <L$, P !@$ 93*@+`@lh!8  !DD<u4s@ <u!(4sH ! Lܧ44@ #|44$A$Ƽ@ < 8g<L$L$ P$!,'@(!(!(!06(!0(!06(!.8(!.B(!-z0!'Я $,(!!,!<&րp@x!$0X0Y  (#@0!!$ !b&s !@@!&1&H@P!B0K`(#$ @0!b&s`,($ '0'ȯ,( 40$!!!4!<&րp@x!!2#$2 @ $(#`0!&!$! !&2 !$H@"!&R"&1P@X!p2 $(#$ `0!&40,($ '8'4<80!(, $l!!@!X?LLp!q $ :@@@!@b ! PP$2O?8!p Y H :$ @c@! ! PP$ i p&@&L@4d$VP!Qr* '`` @&E$` ; `@&E$ : !`@0dC(#$`d ! PP$@!d`p! ;pl8 "@@(!$ : !@$& L< $(,048'`'$!,(P!!@<H!1?xO!`5y- `lT!mP$a TxIde8PTD@&&' 8D@@2$c` :1 ? h-p!`3x+y !kP$a Tn dePTD@&&' D@@$c`(@:1?XK`!`3n+ x!oP$/a TalЭldePT4D&&' 4D@$c` 81?x/!#`1l ) `n!mP$ a TydePTD&&' D@$c` {&w&11?h-!`2y*lc!kP$a TxXdePTD&&' D@D$c`(1 ? X+p!`2x* y )!oP$a TanndePTD&&' D@ $c`&&1!,$('@'ȯH!`!#X!P!H؏0n?x!@HvYykDEH^-,4$@HD<8%&%G $,4$H@D<8؏+H#NHH Hx!  h p!$ԏO!- px!$ԏB@H`^0x?Ȁyh!@WNnODEM/ԯ,$@D<%&%G $8,$H@D<8؏XȀh! x!$Y h p!!%$B@C^0m? px!@WXxODEM9 ԯ,0$@D%&%G $<,0$H@D<؏Mpx! BȀh!$Nx!,h p!$B@`\0o?x!"@UMmMDEK.ԯ,$@D%&%G $<,$H@D<؏O!- 密px!$XȀh!ϯx!$B@`¯ԍ#%)`%J0y?hmp!@TOoLDEJ8ԯ,$@D%&%G $<,$H@D<؏Y h p! !$$Mpx!kȀh!$B@C0n?xo!@TYyLDEJ-ԯ,$@D%&%G $<,$H@D<؏Nx! %h p!$O!-px!$B@#%)`G%Jԏ'8'诿 :$ @@! !````` `````!''P@<HLD80P4(,!!\o!P`d`(\ !!!@`d!`!\&1 !Y(!0!  8!@F$&$'P\`%!$ P!I@ !!`!\&1  !K(!0!  8!@$&$'@P  !(!` % @$!L(,048<@DH'P'!@!' ' 8!'@'ȯ40!(, $!!`"!'l'h$N` !(! 8$ +@$` ! 8(! ` !@ ! C`(!&R`&4 $(,0'8'Я8(8Я$, !!<@@$! IF(!@$BA$! BZ(!$! %*  !@(! J0!<8Ѝrq'p C(!  &18  !'t 8@0! !@J&1F$ &R '| C(!<' C(!6$\' C(!.,  $ , ,  ! 8' ! IF(!$BA ! BZ(!' !@&1$ IF(!$BA$ BZ(! $ I %l , $('0!'HL@D8<04(, ;((! ! **\!$T\$!T@-+!!@!!Q  (!*J IYD : !&s&Ru& ; !\T&$%l%T\' ;L(,048<@DH''؏8!@!P!H!`!`4،de.ԯ( 0!@8! $4( 4  o`!$$ x ! h-p!%! 8! $'(dE* ``ep!F* f! `!`E* veH!*@qF* HfX!lC@0?Ch! $ay0? PJX!h   $ao$@K@G0?C!    $a k$@%@!0?C`!  $ax$@`!`'Я,48<` 00@48<` ! ,'0'XX,\`d X\' '8` LXd$''8@8! ,'X'ȯ$<@!n8 D8Db4 ! 8P88$O0<@'0d $'8'0L8#ЯH@D<04($ $,#!# :$ #@@H!~!<&ր$&x@!2y n2k@`&`@h!2n! &x@!2y! U2c2k`&`@h!2n &x@!2y 2k!`;2c''!'2l>2m? p@ѐ!&x@!&2y? '` ! (#@0!2u' ##$'2l)h@!&p@x!&2x2y' '2k!`'& $ &2m$&x@!2y 2k!`2c#2b`@h!&2c`2n!0O*0!$&@!32k`2l2bh@p!&2o!2x&0S !2b!@+ &@X!s&2l!+ 2m!2nk&x@!2y! 2k`&`@h!2b!2n $ &@!3&2b!2k` &`@h!&2b!2n(!'#!Qܘ&@!3$2k`$B hij ix!X!%lP !& !0` '#!Mܘ$&$Bd '#!!Xܘ&Yܙ&Kܚ& Lܛ$B&C + %J3@!@@(!$ ! ;## $# p#J0!N!@H!$c2b!|&# h#Џ#'xx' '#$2c` ; !#L(,048<@DH'#'PP =,(!$A@!;!P'$ FlLL$A$4$$L :HLH@@(! =<` !!LD` ! =DHHLDF ` ! =<DD ; ! !D` ! =<HDH!p!'P'``,dh `d' '8h\ 8P !`$HX'X$' '8,'`'诿 0''௿(! 0'' '௿  ү@@(! !' 0 ; !' 'د(!` ! >4'@ @0!(<H$r <$$ A !'('诿` :`(!''د$4@!H!` 48` !0! 8! @$4! 8@@$'('4h!pt` ! p'؏p p'Hxh''H'D !D @t4@'h'诿 L'''ȯ04,($ !' ; !!!!$$`!!`!$ !&&1 ;` !&& ; !4 $(,0'8'0 $nbOE 8@ $ 0"$!' 'Я08$ L !80<I($'$ <,$'0'Я< 9$؀@@!9! 9'@4@! 8P !@0!<$، 8P$$!$c* ( ; !( :@!(䏄 ;(! $0!<%ؘ G(!!'0'د(8!$'$ J$$A!$%(z!$'('ȯ<@$8@ "'4@"!4 ! :@@ !!4@$ J040N ;!<$848$'8'HH "'(@|!H'* "',@t!H'0 "'4@ , ;f!H'8 "'<@, ;4 ;R!H'@ "'D@, ;4 ;< ;8! :$ @@!, ;4 ;< ;D ;!'(`!aoa o aoao'H< < x!'诿<I% < <I'H< 8<I%$< ( < I%JH< j$< I%< L<I%< P<I'h< 8(<I%t< (,< I%J< j0< I%T< 4<I%p< 8<I'|< <I8<%< < I(H%J< < Ij@%< D<I%<< <I\'< <I8T%0< < I(X%J< < Ij`%< d P|$''诿 P$''诿 P0!''诿$ P(!''P!NTX!9%O\OT%X,X\XO%YLYh%M|Mt!'-%NlNX$BE1 geF cDh< <A @$ $P#ǃǂD LJjX#DD 8F,lj`!džD8F $D HF h!LjF"1DH<F"BF&cF(cF `F0<EHD @@x!D$!F,`1E P''<!i iDDDNDNj`NJdF `F*4ǑǐE$F04ǓǒEdF2`LJdžljLjF $F D F"1x!1F"BF&cF(cF `F*>E 1 F cF,bǁǀDžDŽF(LJdžF$DŽ F(DžF&džF(LJF$DŽF(DžF&F(F$F(F,DF,F,bǁ ǀ$Dž(DŽ,F(LJ0dž4Ǒ(ǐ,F$DŽEF cF,bǃǂǁ ǀ$F(DžDŽLJ(dž,F(F$DŽDžǑ(F(F&dž4LJ0ǐ,F(F$DŽ DžF(F&dž<LJ8F(F$DŽDžF(F&džDLJ@F(F$DŽDžF(F&džLLJHF(F$F(F&džTLJPF(F&@T@0!' 'د(0$0 Aԯ,(,0 >T$'('8!@!g! P$^!$+O&,c`X&,c$aA`H!$rA$wA`$$4e`$$ 4e`$(!4!($$ P($A@ !'!  $ $rA$$ $aa  (!$ `((A ! < h-! !' $ [8'د >( ?.@@!*N  ?.@@!O  ?$$'(`!$'<$ >4'(@ !$ `$'$' A$'@$ $:b $ $  $@b@$!$' <$ >4',@$!$ ?B''0(,$4 <<< P!!&֘@&ߠ T$  !$ AD0!@@!F! 8P !$A_p!oZ I0 !"0C$B@ @ (D$I @ C I` !@!` !0s` I0 !"0C$B@ @  D$N @ I` !@!` !0s"@!3( "&1@H!*1K`b@}$#Az< @$+$<6H ? !<"L ?@ !@!@hM$:d !'d 7$  @! 8P ! !$: `@0!dT<2R*B@@!&C+`4aA*8c0o4a<8R<2R ? !@!@6Y$:!2 !'d 7$  @! 8P ! !$: `@0!d"<2V*B@@!&C+`4aA*8c0i 4 a<*V<2V ? !<"\<"` ?@ !<"d ?@ !C@!`X!l1 "&1@p!1<1h"@!(1  $:A"&1@ P!K1l$:A < L!@ $,b"&1@b. &1<<1X$BH4 $(,0'p$ [8'诿 Wp @@ !'<B'ȯ<<<!$c$Ƹ@"b$$c@.<x'x#!y<9h$c(i< )*$c X%jX#l!m$c-n&& .o</% $c$$ A(!$@ !$ A($d&@ ! A($d&@ ! A($d#@0!(ad $2$0XY#$ ! A($ed<'8$B(  $$ $px%0$ $$ $!@% 0'(4!0!, $8 !0N0O P$ O!@K!&R@E<&$@ I` !U867! %* '(B* @!@! !$ ` 8!@@!T# q`# p!!A!@! !( P#C*  C !`Q#@84 $(,0'@'<%U<+ &T<j B ! A !&+ ' 'د!$&$ 0N0O$ B !@!! P$$A$ 0X ;$$ `!'('௰!<%U<+ &T B !&+ :! 0b@  $ `(#!*0h @@ I+  B ! 0j@ 0k` @ L+ 0m $!`!' ',(!$ P $B$$0nR.% <8!9Y+ RP$ H %* SaPb B !$A$PV`!0lLP'LL `$$APE $5 @ 0xx@ Y  0iD  C0 !@!!`$$ 0jD@ B !$BAS BZ(! P  % 1 $P`!, $('P'௿8! `(!1D0# < %)@ ! < % Xl !#A!@!#*  ! Cί   `  $7(  !' '诿 $0N 0O P$ 2$$A$7 ` Cth 1*D@ < % `(!x#A!@!@#*  C!''௿(! 1 `0!<'9!H<)!$H4(( <$c`!<$c@`! < `,!$J * $  : @  <5@ (!%  8<  %kH+!< h-!$J* ! ` @ 0O4Y@ '  <xo!cx#AY* ' 40!(,$C $0n!!B@ OO X 0yD  C0@ !@!!`\$H J <Hi!s1K`JB$@!p8# ! B@ !TG$Pp8#! !(! `0!@@(!P#&1LNh#MBx!AO!@!X <Ȁ@!I P#C* @ ! Cί<<Ѱ!K 1l@ B@ !T$ !B! 8P !D (! `@0!@!`!4 $(,0'P<%ߠ!O1D!<%ߠ!O1D!<$x!!$F`!@$!@!H!&$F$X!l#$<$<$x!!$y@!`$!$ H!P!K#$k !h!!$#`!'د$,(, 40  ! :000+ 0(! ;000,(4 !H)(! E$'('ȯ$0,4( !!#+ e` !p@n# !!x !@!@!+  !  (!@5! (! E !A!S+ #@ ! `(!@T!@ ! E`(!@ T!@(! ! E`0!4! ! ! E`(!u!!u!6@#H# * T ! E(! ! ! E (!T!5! (!` ! E0!U!@!4 $(,0'8'(A!8! @0!0  !`(! <\$ $` ! <\(!$0 ! <\(!*0D # !b$n$c$b$cob$xb$yb$c$c$$i$$c' '௰(A!@!8! #@!0  ( !`(!0! <\$ ($0!` ! <\(!($0! ! <\(!$00! ! <\ (!90D # !bn&$c$%'bx$cbj $bl %bn%$$c$c$%&%$$cۡ' '௿$  ?.@@! ! 8$@ ?.@@! ! 8$@ ?!' !@$$@$$$@$$@`!$ [8$ [8`!$ [8a$$ [8$ [8$ [8!$ [8!'Я 0!$0$ M0!$A P$ '$P atPP*  P$ $0! P, =< !, P0(! M0!$ '0$ '诿 $ G'''x@D8<04x(, $h!$! P$v$ 9'h@@!<&1x =$/@'p !$$ $ $$x ! Hb't@!'t a(! PE!!Y$c $B(a 't :$@ !h P$ <$'t't(!$$$$@&b$c$@ a'`h@ ;@ ! $&. $ N ! '$QRSTU P$ $D $(,048<@'x!` $:C$`$B$/N$B`C$`$B@$!!`!0!'+ x<O!B <<$@ 8X$<$B'! !gH$BOx$cd#!!<$ߠp!0 0$!%0$$H!&0$+a$-a0!$ 0C(#$X!l1!((!(@(#$0p!$1@!#`!$ [8!$ [8$] [8!$\ [8$ `!'诿$BA I`@!C$N'`!'诿0!$BA BZ0@!00C%'`!'د !$N Ct@ !B 0O0X4YY P$ L$B 0HD< %JU<*+ &T$B 1lB, B !& + B E0NED $D <x!0# P$Y@YCb$hHI$!J 5K  K L 5M B 0N0OO @$$ '('د( `,(@@8!:!D N @@ @@<x,/! $aa$ra$waY 7(H (!$ G`$$ 5* !,$+l 1 5 !'( 'X<840,($'' Fl'hA< ;$`!hl'' ;'' Fl'hA< ;$tw!hOl]l@! ! ;'& Ft'@@!< ;$[!D =4'hlhh" F@ !; F@ !@ @! F@ !< ;$?!I)$p F@ !@ @! F@ !< ;$-!$p (! ; !' I'HHQLs F@ ! ! J(!' J@(!@! ;' ;(!<$(,048'!$B$ b!(a @!`$B@!$B$$`!'诿0!$BA BZ0@!00C%'`!'ȯ@(40@,$ !!<b!@<O+ X+ U!< @K!<&@!$` I` !T <@IP!%Ki  `#4'%`!B+ @!@!` ! <\ 0! P# qH!Q!a !`!  `p!#"*  C !Q#@@4 $(,0'8'诿!n H!1o g @!0,) y 0@bd  (! `$ g "H#0`l0m ld  (! `0! `0 ` ! B g 0`y0x yd  (! `0! P$ $$A$!`!''௿8! 0O@#0X0Y @!` 0I C@# P$ $  (! `$ @@!lH!`!' 8!*  * \( 00C !$$!@$A$A$$$$$$$$$(    $ $ $ꬭ(  $$$( $$$(  ( 00C $$#$$!@$A$A$$$$$$$$$(  쌋茌䌍ଢ쬫謬$$$ꬭ( $$$( $$$$ [8$T [8$K [8$N [8!e'௿` ! : @@ !`(! a' !'p8(<04p, $!!lC $0oB@ XX Y 0hD C0@ !@!!`!plD K<H!`+D !+ |!CM+ !N 1D/  D `(!D@!YH 5 AI !l*@ V$`!#@@! B@ !S lpX!%m p#AP#@@!+ ! !(! <\ 0!XH#YBH!AI!@!J <  Xh!Lx#*  C@ !#C 0nD 0xD ! `$ @ B@ !pCѰ!< $(,048'h$0$ B0$c`!!$$$& [8$S [8$C [8'!`! # ! P $dAp)2 $dA$dA$c`!''௿ N:'@$' ' < H!%ߠ$.'0$' !$ $ X$ x$ 0E $e@0!$$>>#p!1f$!$c1 1$a$Ay#!$c $>> Q+ J!C$B$!$  !.1:!$B' X(#($/! ,CȀ<9!9#  # $<4!~$% $1t(x%38% $1t(.x%3r,%3/%! #$ '@'@, !($!' PP$'8 ;(!'(! d'8@o@!$$/N.@xx#x!$P#&#` ! d(!L@! ! = (!@Ȁ2#Ȁ@@! ! D'@ ! D'@H2H# H'< J< J%k(*!%ЬKܬL"&R ! D'@ ! D'@hh# h'<J<J%!'OܬX &R ! D'@ ! D' ! d(!@!@*A @ <$' L$!$, $(''௿ d$Џ N' '诿 d< 9$@@ ! N$''$Я,( !! O~d f@`!$.d o$c b` !K f44@x$c` ! =$.<9<@! 0&<J&R(B  g` !@@!@  !@!` ! @!@`!$c! @ < %k&  + @$c$ !, $('H'Я($ Я,!!! O~<<&$c<&1$c` !(!@ 0!@@!`! & + @$ !, $('0$Q [8a$Y [8!$n [8$o [8$ [8$ [8!$j [8$s [8$' [8$: [8xx!$ [8$ [8$ [8!(a  p<.!$c$ !$'௿`$b<% p<&1 π! &+ ' '4HL$$BA$@A@!D# 61%Kh`$썕$!!$p2-D61 &Вp<p!ߡ22@1<$cߠ!@!p$Bp!)&s1*@@@!@!p6161p2+` 쏯%p$V29 쏬%*HX$mK쏹%$ C9'C2+@!@!` 22@%p$ '(H$*a'($ <4a$ p#'B Q'$2/',$4$2) '0$ 4$)  !@$k0&$ a`!&pp!p@Nx#%0(a  $y0&@ 'C4P##@@!į612# `2,@$!$2# 'C2+!!` 22@%$ %*H`$썍<ap$'B Q'$'C$$!!22@$x'C$!!$22@29 %*H`$썍 %nx$$X<$c<$c  !@$ $ 61 22@<4D`$lh!pCx$&@@ 'C##@@!į612) #@2,$ $ 61'4$4$'8$4 $$X$o$x2# ` 2)@  $!$2# 2*@@$* &$'' ''' P쯠$@!$A@ '< 8P!'<K!$2# $A2.<&<& 8P !$!2# $A <$( 8P!<%(O!$2#  !'@$ 4$2*@'D$ 4$2+`'H$4$`0b8'9&$08'929 $ .&` $&&`61 '-0'8-%`!#(A  0$ A$cX(A %n0 n00$O0o$c00',+ ',$0!$BD+ C0  @0$ +%00$-%0<!ߡ3  0$ E%L00$e%00'-#61"P! '2# 2+@`$*< (!$<$ '' '' P'$@!$A@ 'L 8P!'LN!$2# $A28<&4<&@ 8P !$!2# $A <$L 8P!<%LO!$2# 2% P#K* $0'P$4$2.'T$4$2) 'X$ 4$'80!`( $ 0&0b$&&$$ .&*<  !$<* #61$'.`( $0&0b$&&$'8x2# 2/@$$* (!$'' ''' P쯠 $`@!$ 2-! 8P !U* $@!@ !Y$0!&R@$BN$0+ * I&U&O#8'8 '9'8%*HX$l'98(2# %(p$$'\!$28@ 8P !$!& &E$B&$V2# 9&s`2/$!$$#IP!K !*0! x܏xh!<܏܏x28 >p!2/H#61ď^X!d`#(0!2-%<c#@ @!0r$BA @ !(! BZ$2% 1  $&$@$@"!4$BA 0d(! BZ$c% 3. $$&RX&2/%<B  !0R$BA @ !(! BZ$R%l 1  $&!!!$BA0d(! BZ$' 1* @$&RV&2+`v2,%<B !0R$BA @ !(! BZ$2% 1  U$&2*@% !`!0$BA0d(! BZ$% 1 /$ &RO&2) %* "<c#@@!0q$BA ! BZ(!$Q%l 1  $&lHLPTX\`dh''<$cߠbp!$1 $b!,1$ +KP!$$-A$ $'$!0!'$$'5$B,A  8n0!@$0#H`$$$5A$A$(!!K$$ A$$-A$$$B,A  xx!x@!$$B,A  #0!DD( DD(5 ǃpǂt !(# iT``F @F F 'h<cd$ ! <`!$d[8<B`+ @ !$ <$d!'ȯ X\88'(# Wȯ(@0!C!IK PIP! PIP! P `NIP!`# a@ PIP#`!y a Qx#Y0xLh!!!4 $'0', Y4$4040,0l* ,n* 8'(# Wȯ($@0!H !'8'د$ <4QE $<A ae!&R$<a<p.$<aA<x/$<A<8<p4!A!$!<@(@"$F jZ$F@$n$mB* % jZ !@$n$m&1 ! jZB#@$n$mB* A $F&0 jZ !@$n$mB!@!<1<2@! jZ !@$ <)r< Jp!J* < %kpc`!#C&1* $B$ <,r<& -<1Џ$<< '($B'௿ 9'@1@! X !@+@! !' X$@%@!4%0 X !@@!$C`$;a  !' X$@ @!Y$;!&'0 YD'4' <$ߠp!$1!$B@ $$!(1  X!l1 $x!3 $B@$ $BA$!'Я4!!8! (8G-,$+A&, !'( Y $,$@*@!(N`!a#@a!$: ,&'( Y $,$@@!(Y#$:!x!,&'( Y $,$@@!(h!4H#I4c!'0<$BߠNx!3 !$H(H! H@K`!%ЬNx!3 !'ȯ $<!@(, ! Y '4@@!B!4$/%4X &', X0!@@!2!Y$,!& Y '0@@!&!0$/% 0JA &'( X0!@!4<4cQc,<$`p!0(@(H!*X#lh!$ '8'诿<@!*H! !<$BO $c* $B #<'9!J ! K+ Yد  % Y !<" 4cQh% /'9''(: !d jZ@$n$m(!$nxx#!'($'H#'!   `A$(A< $<AyX! ` (a< $<ahp!x( $ `X!  (  $ h-p!x  jZ !@$n$m$nA$<8r$<9r<X@K!Bp H* *$ `#$  % jZ@$n$m$nA$<8r$<9rX@<K!Bp H* )!F $8! !< %ph@!!N$BC+ 8!%#xx#xx#xx#$xxx!!$B!$!ȃX!%m$$'@'<0!`p!</r Y\ XyX! XyX! X `yX!`# a@ XyX#`! a Yylp!x# x@!- !+\8c``!<+$C1  -@+ <%+ % . $'   $BA '-%l   Y ! @ x%+!  Y !!'`$h [8<"p$' $@ @D'480$D@<,(<!!p&ߠ$dq&s pp!1PD @% @ `$$bA I` !@!C$K ` !`!1!@%@ `$$bA I` !@!C$H` !H!*1K`@(!% jt@$A$D$%!q$%!(&s@%@ `$$bA I` !@!C$H` !@(!%* jt@$Ap$*!!q!&s$X!l1 pp!p@ѐ!q&Rx!&s3 @<6R$l! !$h!$L!q&s$$L$l $[! ` ! `F'x@@!$!H1  $E!$G!$X!$lQ$n!D@$c!|$[!y@%l@ `$$bA I` !@!C$N` !x!3 !@% @ `$$bA I` !@!C$K ` !`!1@(!% jt@$A1[' ! (!@0!'x _;$h $% !P$L@$l $%x$@8$% !P$L@$[!$c!$i!$n!$s!' ! (!@0!8! \@px!pDp $p !p !$!D$(,048<@'x'040!$n-lhH!'h!X!`! dp<.!.%p$l$ $ $x$ k!@'@ $d$$BAԯد|tp ! I`xԏ؏|tpx@ !D$X!`8!$h%) @$d%@ `$$bAԯد|tp ! I`xԏ؏|tpx@ !D$Y!$0a`8!$i)! @$d%@ `$$bAد|tp ! I`x؏|tpx@ !D$Y!0b$xA$XA $d`'@$d%@`$$bAد|tp ! I`x؏|tpx@ !D$X!0bد|tp'$ Px؏|tpx$A$@'.@<x!ߡ1)! $ ؏@|t'.@p@ !(! jtx؏|tpxJ%)@8!G%)؏@|t%@p@ !(! jtx@؏|tpx'.@ jt(!؏|tpx"؏@tp$ %@|@ !(! jtx؏|tpx $+a$-a$0a%) '+  P$"!<G!Bߡ0C`$A#0N `$00O$7$W!#J*  l dNx!dQ%l z$.`!`G%k$e$Enl!`i%@$d%@ % $$BAد|tp ! I`x؏|tpx@ !D$N!<C!Bߡ`8!0O %)$+a$-a0X.@$d'.@ %$$BAد|tp ! I`x؏|tpx@ !D$Y!%)!O`8!^\l&x V'hxF F $l! $C$ca$Cn=$CF  $ca$Co3hdd< #$l! $C$ca$Cn$h $C$ca$Cx $C$ca$Cy$@x%@ ! jt(!x$A$D!40''ȯ88$ D @!L$D$ $D,8!,$c<4!$@H%@ $d! @$$BA @0 ! I`<@0<@!C$K ` !$ S$s< `!ߡ1I$[Dx!?8 $7$@$d%K@ ` !$bA @0 ! I`<@0<$ @!C$M ` !$s<p!ߡ1 $[D!*@@$ %D@@0%@(! jt<0<$ I$D, !8@$c$$ '8'Я!,( $$^!!$&` !.E >$$]$-$-dx!&&!qC* b0#$b ! >@(!&d!&!, $('0<`<1$cT$cx+ !y 3(`!$ [8'诿!` ! B(!d `0!o n1Ϡx b `0Y n0Hh '$ 0$E$!$!$ $$F!$!$ [8' PPP$$T j'(A$ P!$'P'௿ jȯ j@ !' $9 [8'د! ! j!@! 8P !"! $X&$,A $ a&x%0$B,A &$ a  ! j(!@$B0B,A{   ! j(!@ ! j(!@  !'('诿$ P(!'j(  #0c`(# !$8$ (#8! $ $8$(#8!$(!$'XX\PTHL@$D8<@!t<&ּ(% !$ 6@!$ !(! !@0!8! j쯨A@!$ !T!<&6 8P !˜!$ &s b#@ ! !(! kB!&&1  ! k(!!&1 &@$$ !<< $B<"<< $c<%Kp#@!!` !+ (!0!`8! j쯷@@!! lp !&@! lp !&@! lp !$@!!&< % + ~!& 8P` !b!#&st&$ !(!0!`8! j쯷Ac!<<3q$B$!< 3 <$  (! =L0!I!< )I@!tJ:!<"$At$ <+< <3 8P` !b!&s2m p#n!&s<%(t!O+ < 3 <$ =L(!p !s$cpd`(! L0!d!'@!$B@+ ]p<$B $ !\8<@DHLPTX''௤  N:'P@$! <<'8/< <$$9(<'P) < %J<<*$B' 'Я$'0$ f$A@(!< 1< =L$ 4 P$A P$~A$c!'0 a0!'0'ȯ@@$$<@!I!1<3)$ H8'00 8X08$ '0$$ f '48A@(!< k 1l< =L$ d P$A P$~A$ c!'4$ a88@@! !@<n<'Po $ `!$'8'௿` <$ >4'@!` ! `ď %' ' A''௿ <$ >4'@@0!$u!<$( AD$@@!$h!X$# ! l'@@! ! l'@@!<'X<%(9&X N, !< )<*$ B$ +,$ $ $ &<$B<0"@! ! l'$ $ @@!@$P!`&< % -+ 0&1 ! l'$ $ @@!@$P`< $B' 'د!$  c ! c@@!D D (!@P D (!@ & c@@! c$@! '('د$! !! c ! c@@!N. @(! l`0!@ c@@! c$! '('د,`0!!, ! l$$!n` ! !, l @@!`@$C`!'('ߘ<840,($< $$5. / <$<PL!8 9$ @@8!< & <&  !(! ;$$P<$ >4'@@0!'X$ AD d@<&s $ $ 'X' 8$@%P^'^"B$"B@$ A !(!$ ;دL ! m$ @@'X' 8$@VP ^'^"B$"B@}$ Az$ L !(!$ ;! ! m$ @@<4 < k <8!`$ Ȁ"B$$!$@+ @ " B $@"B<<$ 'X 8$ @,* )b'b"B$"B@"$ A< % a!D N, !D$Ab`$$5no& $c<$ ('X D$ @ N'd d'X AD$ @;* <5 d A< 'X L$@ 'X m$.@@8! ! ;$L -<4 < <$ 8!!< %) "$.b&$@<$ * <&1 !$. m \ \&$C*`8! $+ < J <<$(,0485K+ ' h!<D!Bߡ0B'< DX1\`d d$Ay$< 3 <X\` =L$ `X\`'X$   ! m@@!< J 1K`<$ x =LPP$ N`!dh'X m`(!A@!<  1<$ =LPP$6`!d0*<9 3( < =L$ d% 8!0!,A P<*!*%@$  $ $ $$`!D'X'@<D8< 041LP!T! d$A}$ P !$삙 ! ! $.$.&R$@@ g !@ @ !XLPT f Z@< ) 1*@ @<$ 8<  12< <% ,!$TXLP ! gJ@@!2`! P$A$)$q&s$aq < 1  &@TXLP !(! gJ@@!`!`$$D048<@'H'< 4'L1X\@!!H\<XTP$ (!`0! =LTP` ! 8PPP$CH!*$.A `0!,a  !'L LDDX! `L H<$ $ 'L$8! 8XdHX\` f 4'P' @$<  9$ @@ ! >4' @@!h! /'0$ AD@0!@]<&1ߠ0'0@"p!1 &@"!(1  @C @ D'0@7&"X!l1 &"p!1@+& @!H(H!*1K` b$c@"`!1<&1P`< O !(! ;$ A@ !  !'0$ AD@0!@ A@ !!$ ' @Dh<-4! !0$D`0$0 $$< $$$ $$ $$$$D`<-4! !0$0$0$$<@ $$$$$ $$$$!$ $ -h@Gh%<H#`@$!$ h%J B*$ j j< h% p@"'!" 08gX#, `#(#$,  $ 0$0,5$ T$9$S&( $,  (!$ $$B80$0 , =, =.$0$&hp'p+ @!`! hp'p+ x!-H!p'p+,H!`! hp' p+MP!x!p'p+LP! h`!mX!lX!' 08$0$gX#ܠ' 8 @  %g8$0 $($9-0 % ($0(%)$1($0 $B $0(!(!$ $$< h@ Gh%@$' `@M-H!*H#$ *'U<(!%% J <%% $ % <!(!$  $ H p' p+`! H@!h!h!X'jX+h!`!$ h@ h% `@j p@!`@X! P!H!$$c 4$%0%%0%%0%%08p#n!$c` p#%)4 $ @!@H!`P!$ %% x#@0@%0H&H%P0FP% X0XfX%P0FP%0H&H%@! H@ 1H %J@%k :$c XB,a $ccX!DD <!&D DD '840,!( X\! Y@ !$A P$R$<$ 'd qF@0!<'X'T'P'L$ 'd'` ='\L<H\4!%*J\XH(H!T H(H! H# iP@(H!h# h H!(H#mp!! I`)P!A`!)aD $ jJ !`& * "!DN /!(!9! !4(,0''诿 jZ@<4B<4B3'0%$dx$$!'0!$B$ 1X+ C @  ! Ct$h$@  ! Ct$BF 1l %*0m4n !'$ [8$ [8$ [8!$ [8'<, s''诲 h!`!$!@! W$($\$.$.$1%.E(!+ H$% p!+ @$I!%) 4$BK%Jr  x!%+ 1$%L+  %)$%)!aF#$cO19?r1%P!M+ L+ $$Bx#O*  $ $I%J aF#`! '' !`!$X!@@!Q&R N@h!%(,,,!$`jP$ \$ . 24<(HD& (!@0! l,4<HD,P$ .$ \@@ !!'+ X$r5%%0'K #'+ % !%i&j&`p!+  (*$%`&#$B@`%@(A@  ($`!+  ($% #$ '@+ !$@0F$b!$$ce+ b$c@d#'+ `! J!$.$\$.$ E!0!6$1  -'#%j .*j$c@X!$i%$c%h$c# $1?p%(! @!$o#$BG+ $ '0cn%0Bn%o%x%0r""r` !G$BN!$@!( 4&0B@#30#`! !C4(!$8$$0#8!$C*$8#0 0#8!$C$$8$ 0#8!$C$8!$C$!$! !gH$BOx$cd#$!$'x<8< 41 <$ 0 =L -  $ !$ PP<9 <'++ "1Mpx&1lB,"X&+<  #1 p+1&_ fBh&-< "1@+3."X&1l$h&x$-/&) T !Xt%%u$'| (!0!'T kZDDA@!e$#!@# l(!& l(!$9&`QM%'|0!(! kZ'TA@!C$!(! l$ & l(!&(! l !&(! l !$ &.- % * '$ %0 l(!& l(!&(! l !& l(!& L(!!$9@$A#<48''`PLdX\TH@D< 该1!!$~< =L$ P s< 3  d$A$<B 0B+@@!(c8c< ) ܕ <0& !< J !@r< k 1l<% i0x! x<$ \& =L@0!<B 0 p!50$$ M0!A@!0 P&< @!1  < y $ 0*< %k QK(! !$ N0A P&<  @!1< y $ 0 =< ! $쏑0'|$0C'|$$P ! y@P P&<9 @!3(< y $ 0 =< !$0$`!`(!$ =D !@@!0Ii#0c`! 0(!`0! =D !@@!@ P< J @!1K`< y $ 0 =< !$x$$ &&r`!* < 3<<$ 8$t$p2C`0`(!`0! =D !@@!0Hh#0c`! 0(!`0! =D !@@! P&< ) @!1*@< y $ ؏0 =< !e$p`&l$h$5nXx#  !,a $`!0'x0! =D !@0Hh#0c`<B 0B!0$$ M0!A@!0 P&< ) @!1*@< y $ 䏑0< k $a640<' q(! !$ N0A < &1  y '40$̏0菦8! y !I4< J &1K` y '<0< % a!0<$P !$ N00菦$8! y !O <9 &3( y 'D0< ) @I< k K` $a<A @$' PP$ 0'aB h!X$2/@H%I''0!8! =$&$A < k &1l y 'L0x@ <  &1$< =L$ 0j0`(!8! y !@@!<9 &3/< y $0Tx$< 1  =L ! s` !< J 1K `l o w$1O< =L$ 0 =< !<B $<B 0B@< =L$4 s` ! < 1  < k 1l0 =< !$00@!<  !* <B <B %"* ௑00  ! =<0$0@  P$ P$~ P !$d@DHLPTX\`'菄0'$ =<$0'% @@<h!@<(!c(.'P/'TyY X<+!+('P@KX _1 $ 4%%)<@@< i!HP! H@c(fJ(<<< < p!x!`!h!&x&|'X'\j! y$c` X@ GhX% G P@HP% H@$c OIp!`x!'yp!$ %%)%'௿ $ Wp ! $ qF@0!' 'Я,$ (!! r⯤0@C` 9'@@!N<R0C00b@r&R<&s$%HgC&R$o-U [x</!/(X&8ȀyH!#`b@Nb&@$cG* Xk`!|b@=b&@$c6- pnx!b@,b&@$c%8ȀyH!#0b@b&@$c<0 ! qF 0!! $%$ (! sh$@!$%<$ ! qF 0!!$%$ (  $ &$ (! sh$@!(! sh$@!$%$(! sh$@!$%"(A  $C@!` !(! sh$@!$%$(!$ sh$@!$%$(!$ sh$@!$%$(! sh$@!$%$ &,)  < 8!bb&@$c<4!bb&@$c<$ ! qF 0!!$% !' qF 0!!|$%$(! sh$@!t$%$ p&<$ ! qF 0!!h$%)*$*#$BA(!$@ ! sh@!X$%$(! sh$@!P$%'$$+$g`#!A(!$@ ! sh@!:$%<, ! qF 0!!2$%<( ! qF 0!!*$%$(! sh$@!"$%$(!$ sh$l@!$%- < pn!ckb@b&@$c O&&&B&R@0,#($ '0'诿$< 9$`@@ !N <r<'P`<$P 8x`@g<` ;$<$ P(!$A\@ !'8 y௤4@WH :$@Q@(!H4X P0!HGX ;AXH$ !@ !I $@!H$c(a+ X`!d !$ $ `ЯM@$PXHX$+a<$'d <\$<`$P ;$@  ; X 4 P$ '!$N- -p<.!.*$$@#!$O0 #$d$@@#@@!$Y0@ #$ $H%*0$ $X%l0!$# [8'诿< s$d''د! !$<&q $X 8@ !n<~@Ȁ0!<$d 8@ !<f$t 8@ !h<1  P0!<$ 8@ !<$ 8@ !bY`@ ! 8'Ȓbg@ o@ ! 8'̒bw@ ! 8'Вb0X@ ! 8'Ԓb @ ! 8'ؒbF@O @ ! 8'<f$ 8@ !<f$ 8@ !<f$ 8@ !<f $ 8@ !p*<$ 8@ !&#@ ! 8' !`(! t@0!@b@! lp ! w@ !<$@ ! 8@0!&1 lp ! x2@ !<$@ ! 8@0!&&1p<$ 8@ !& @ ! 8' !`(! t@0!@4@!&p<$ 8@ !& @ ! 8' !`(! t@0!@@!&p <$( 8@ !& @ ! 8' !`(! t@0!@@!&$ '('Я08$!0$` !$e j'0A@!!0$.018'0 C䯣,,0#!$'0'0,$<8!!!4(  !`0! t (!@@!! lp !@! w@ !<$@` ! 8@0!& lp !@! x2@ !<$L` ! 8@0!& lx ! xP@ !<$\` ! 8@0!& lp !<$ht` ! 8@0!&d !'h L$t$h x<$x` ! 8@0!t+!t$!'h x<$` ! 8@0!<$ 8` !< R$` ! 8K0!t !B$At!dtϨ!<$ 8` ! ! (! t`0!@!` ! 8'dt!&<$` !0! 88!!& <$` !0! 88!!dt !<$ 8` ! ! (! t`0!<@!$ 8` ! ! (! t`0!@! lx@ !<$ ` ! 8@0!& lx ! xP@ !<$` ! 8@0!& lx ! xP@ !<$,` ! 8@0!& lx ! xP@ !<$<` ! 8@0!& lx ! xP@ !<$L` ! 8@0!dt&K! lp !<$X` ! 8@0!<&$l 8` ! ! (! t`0!dt@!|!' C`(!t!+ p@!$\$ &ge!+ b;$\ IF`(!b$BAb ! BZ`(!xy'(h `(! IF&3b$BAb`(! BZ&'j&Bk%ll`(! IF&b$BAb`(! BZ& n&o%x&1 + + ' C`(!dt(!<$x 8` ! ! (! t`0!<@!$ 8` ! ! (! t`0!dt@!*!<$ 8` ! ! (! t`0!<@!$ 8` ! ! (! t`0!dt@!l!` !' 80!td!ͨ!t$ lx !` !' 8@0!&dt!t,A d! !'h L$h& x<$` !@0! 8&dt!K!+ ' &2,` !@(! 80!&2@+ $ IF`(!wb$BAb$ BZ`(!mx$ y'(eh$ b* 9$K*  #$q* $?* $-$4` ! 8'td!<"!$($ *  $ $ $(* $* $3$$eK*f $d;$f@<$` !0! 88!!` ! 8'!< $(,048''诿-0!'' '$','0'4'8'<'D'H'L'T'\'`'d'h'p'x'Ā'Ą'Č'Đ$( S$ (  ,$( $( $$<$` 8X'Ĕ<X$B`$(  $$ $( $ (  $ $ $( $$( $e(f $d$f$( $~$}''0!$ $$ 'Ę 'Ĝ'Ġ<$` 8X'Ĥ<$B`''!`<$` ;'Ĩ<$B`$<a<$`Pa$Ha@`$a'İ'Ĵ(<< $$``0! 8X$<$a( $$"`$ $$'ĸ'ļ(< $0! 8X$( $ $$` #`$ $$!''į(< $  0! 8X$( $$$@` ` $ $$A''<$ 8X@0!<$B`'('௤ #"! <<31$0$0 8X0<$B' x<'%@(!@ $O* <8!9$ ! 8P((@@0! `$$' `$$ 8P$$ `@0!$' `$'('(0, !$&4!!!'@;!0Pp!-P *@ !'@ GX@0!@PD!R!@!3`!!'@% ! GX0!@PD!/O!@!`!$`(! L0!0P!p!&&1@  !'@ GX@0!@PD!!PD`!4 $(,0'PP$M [8$O [8$I [8@H 8'0P8+&H!GP  8'0X8+&H!GP @0'0+KP!@8'XfX 08+gX FP!$ [8!@(#) $Header: wbimport.c,v 1.5 93/08/04 02:58:25 van Exp $ (LBL)lox-displayX display nameo ,,,<P,`x,-displayX display nameWbImport.xidwb window idWbImport.tmpfiletmp filenameWbImport.scanCommandscan command to execWbImport.propNameImport X property namewrong # args: should be " xwinid propname value"wrong # args: should be " xwinid propname [del]"handleClientEvent %lu %luwrong # args: should be " classname" cant get root window treewrong # args: should be " xwinid": invalid window id "wbimportWbImportsetPropertygetPropertygetWindowByClassgetWindowNamewbi_run proc tk_butEnter w { global tk_priv tk_strictMotif if {[lindex [$w config -state] 4] != "disabled"} { if {!$tk_strictMotif} { $w config -state active } set tk_priv(window) $w } } proc tk_butLeave w { global tk_priv tk_strictMotif if {[lindex [$w config -state] 4] != "disabled"} { if {!$tk_strictMotif} { $w config -state normal } } set tk_priv(window) "" } proc tk_butDown w { global tk_priv set tk_priv(relief) [lindex [$w config -relief] 4] if {[lindex [$w config -state] 4] != "disabled"} { $w config -relief sunken } } proc tk_butUp w { global tk_priv $w config -relief $tk_priv(relief) if {($w == $tk_priv(window)) && ([lindex [$w config -state] 4] != "disabled")} { uplevel #0 [list $w invoke] } } proc tk_entryBackspace w { set x [expr {[$w index insert] - 1}] if {$x != -1} {$w delete $x} } proc tk_entryBackword w { set string [$w get] set curs [expr [$w index insert]-1] if {$curs < 0} return for {set x $curs} {$x > 0} {incr x -1} { if {([string first [string index $string $x] " \t"] < 0) && ([string first [string index $string [expr $x-1]] " \t"] >= 0)} { break } } $w delete $x $curs } proc tk_entrySeeCaret w { set c [$w index insert] set left [$w index @0] if {$left > $c} { $w view $c return } while {([$w index @[expr [winfo width $w]-5]] < $c) && ($left < $c)} { set left [expr $left+1] $w view $left } } proc tk_listboxSingleSelect args { foreach w $args { bind $w {%W select from [%W nearest %y]} bind $w {%W select from [%W nearest %y]} bind $w {%W select from [%W nearest %y]} } } proc tk_menuBar {w args} { global tk_priv if {$args == ""} { if [catch {set menus $tk_priv(menusFor$w)}] { return "" } return $menus } if [info exists tk_priv(menusFor$w)] { unset tk_priv(menusFor$w) unset tk_priv(menuBarFor[winfo toplevel $w]) } if {$args == "{}"} { return } set tk_priv(menusFor$w) $args set tk_priv(menuBarFor[winfo toplevel $w]) $w bind $w tk_mbUnpost } proc tk_menus {w args} { error "tk_menus is obsolete in Tk versions 3.0 and later; please change your scripts to use tk_menuBar instead" } proc tk_bindForTraversal args { foreach w $args { bind $w {tk_traverseToMenu %W %A} bind $w {tk_firstMenu %W} } } proc tk_mbPost {w} { global tk_priv tk_strictMotif if {([lindex [$w config -state] 4] == "disabled") || ($w == $tk_priv(posted))} { return } set menu [lindex [$w config -menu] 4] if {$menu == ""} { return } if ![string match $w* $menu] { error "can't post $menu: it isn't a descendant of $w (this is a new requirement in Tk versions 3.0 and later)" } set cur $tk_priv(posted) if {$cur != ""} tk_mbUnpost set tk_priv(relief) [lindex [$w config -relief] 4] $w config -relief raised set tk_priv(posted) $w if {$tk_priv(focus) == ""} { set tk_priv(focus) [focus] } set tk_priv(activeBg) [lindex [$menu config -activebackground] 4] set tk_priv(activeFg) [lindex [$menu config -activeforeground] 4] if $tk_strictMotif { $menu config -activebackground [lindex [$menu config -background] 4] $menu config -activeforeground [lindex [$menu config -foreground] 4] } $menu activate none focus $menu $menu post [winfo rootx $w] [expr [winfo rooty $w]+[winfo height $w]] if [catch {set grab $tk_priv(menuBarFor[winfo toplevel $w])}] { set grab $w } else { if [lsearch $tk_priv(menusFor$grab) $w]<0 { set grab $w } } set tk_priv(cursor) [lindex [$grab config -cursor] 4] $grab config -cursor arrow set tk_priv(grab) $grab grab -global $grab } proc tk_mbUnpost {} { global tk_priv set w $tk_priv(posted) if {$w != ""} { $w config -relief $tk_priv(relief) $tk_priv(grab) config -cursor $tk_priv(cursor) grab release $tk_priv(grab) focus $tk_priv(focus) set tk_priv(focus) "" set menu [lindex [$w config -menu] 4] $menu unpost $menu config -activebackground $tk_priv(activeBg) $menu config -activeforeground $tk_priv(activeFg) set tk_priv(posted) {} } } proc tk_traverseToMenu {w char} { global tk_priv if {$char == ""} { return } set char [string tolower $char] foreach mb [tk_getMenuButtons $w] { if {[winfo class $mb] == "Menubutton"} { set char2 [string index [lindex [$mb config -text] 4] \ [lindex [$mb config -underline] 4]] if {[string compare $char [string tolower $char2]] == 0} { tk_mbPost $mb [lindex [$mb config -menu] 4] activate 0 return } } } } proc tk_traverseWithinMenu {w char} { if {$char == ""} { return } set char [string tolower $char] set last [$w index last] for {set i 0} {$i <= $last} {incr i} { if [catch {set char2 [string index \ [lindex [$w entryconfig $i -label] 4] \ [lindex [$w entryconfig $i -underline] 4]]}] { continue } if {[string compare $char [string tolower $char2]] == 0} { tk_mbUnpost $w invoke $i return } } } proc tk_getMenuButtons w { global tk_priv set top [winfo toplevel $w] if [catch {set bar [set tk_priv(menuBarFor$top)]}] { return "" } return $tk_priv(menusFor$bar) } proc tk_nextMenu count { global tk_priv if {$tk_priv(posted) == ""} { return } set buttons [tk_getMenuButtons $tk_priv(posted)] set length [llength $buttons] for {set i 0} 1 {incr i} { if {$i >= $length} { return } if {[lindex $buttons $i] == $tk_priv(posted)} { break } } incr i $count while 1 { while {$i < 0} { incr i $length } while {$i >= $length} { incr i -$length } set mb [lindex $buttons $i] if {[lindex [$mb configure -state] 4] != "disabled"} { break } incr i $count } tk_mbUnpost tk_mbPost $mb [lindex [$mb config -menu] 4] activate 0 } proc tk_nextMenuEntry count { global tk_priv if {$tk_priv(posted) == ""} { return } set menu [lindex [$tk_priv(posted) config -menu] 4] set length [expr [$menu index last]+1] set i [$menu index active] if {$i == "none"} { set i 0 } else { incr i $count } while 1 { while {$i < 0} { incr i $length } while {$i >= $length} { incr i -$length } if {[catch {$menu entryconfigure $i -state} state] == 0} { if {[lindex $state 4] != "disabled"} { break } } incr i $count } $menu activate $i } proc tk_invokeMenu {menu} { set i [$menu index active] if {$i != "none"} { tk_mbUnpost update idletasks $menu invoke $i } } proc tk_firstMenu w { set mb [lindex [tk_getMenuButtons $w] 0] if {$mb != ""} { tk_mbPost $mb [lindex [$mb config -menu] 4] activate 0 } } proc tk_mbButtonDown w { global tk_priv if {[lindex [$w config -state] 4] == "disabled"} { return } if {$tk_priv(inMenuButton) == $w} { tk_mbPost $w } } proc tk_textSelectTo {w index} { global tk_priv case $tk_priv(selectMode) { char { if [$w compare $index < anchor] { set first $index set last anchor } else { set first anchor set last [$w index $index+1c] } } word { if [$w compare $index < anchor] { set first [$w index "$index wordstart"] set last [$w index "anchor wordend"] } else { set first [$w index "anchor wordstart"] set last [$w index "$index wordend"] } } line { if [$w compare $index < anchor] { set first [$w index "$index linestart"] set last [$w index "anchor lineend + 1c"] } else { set first [$w index "anchor linestart"] set last [$w index "$index lineend + 1c"] } } } $w tag remove sel 0.0 $first $w tag add sel $first $last $w tag remove sel $last end } proc tk_textBackspace w { $w delete insert-1c insert } proc tk_textIndexCloser {w a b c} { set a [$w index $a] set b [$w index $b] set c [$w index $c] if [$w compare $a <= $b] { return 1 } if [$w compare $a >= $c] { return 0 } scan $a "%d.%d" lineA chA scan $b "%d.%d" lineB chB scan $c "%d.%d" lineC chC if {$chC == 0} { incr lineC -1 set chC [string length [$w get $lineC.0 $lineC.end]] } if {$lineB != $lineC} { return [expr {($lineA-$lineB) < ($lineC-$lineA)}] } return [expr {($chA-$chB) < ($chC-$chA)}] } proc tk_textResetAnchor {w index} { global tk_priv if {[$w tag ranges sel] == ""} { set tk_priv(selectMode) char $w mark set anchor $index return } if [tk_textIndexCloser $w $index sel.first sel.last] { if {$tk_priv(selectMode) == "char"} { $w mark set anchor sel.last } else { $w mark set anchor sel.last-1c } } else { $w mark set anchor sel.first } } scan [info tclversion] "%d.%d" a b if {($a != 6) || ($b < 5)} { error "wrong version of Tcl loaded ([info tclversion]): need 6.5 or later" } scan $tk_version "%d.%d" a b if {($a != 3) || ($b < 1)} { error "wrong version of Tk loaded ($tk_version): need 3.1 or later" } set auto_path "$tk_library [info library]" set tk_strictMotif 0 bind Button {tk_butEnter %W} bind Button {tk_butLeave %W} bind Button <1> {tk_butDown %W} bind Button {tk_butUp %W} bind Checkbutton {tk_butEnter %W} bind Checkbutton {tk_butLeave %W} bind Checkbutton <1> {tk_butDown %W} bind Checkbutton {tk_butUp %W} bind Radiobutton {tk_butEnter %W} bind Radiobutton {tk_butLeave %W} bind Radiobutton <1> {tk_butDown %W} bind Radiobutton {tk_butUp %W} bind Entry <1> { %W icursor @%x %W select from @%x if {[lindex [%W config -state] 4] == "normal"} {focus %W} } bind Entry {%W select to @%x} bind Entry {%W select adjust @%x} bind Entry {%W select to @%x} bind Entry <2> {%W scan mark %x} bind Entry {%W scan dragto %x} bind Entry { if {"%A" != ""} { %W insert insert %A tk_entrySeeCaret %W } } bind Entry {tk_entryBackspace %W; tk_entrySeeCaret %W} bind Entry {tk_entryBackspace %W; tk_entrySeeCaret %W} bind Entry {tk_entryBackspace %W; tk_entrySeeCaret %W} bind Entry {%W delete sel.first sel.last; tk_entrySeeCaret %W} bind Entry {%W delete 0 end} bind Entry {%W insert insert [selection get]; tk_entrySeeCaret %W} bind Entry {tk_entryBackword %W; tk_entrySeeCaret %W} tk_bindForTraversal Entry bind Listbox <1> {%W select from [%W nearest %y]} bind Listbox {%W select to [%W nearest %y]} bind Listbox {%W select adjust [%W nearest %y]} bind Listbox {%W select to [%W nearest %y]} bind Listbox <2> {%W scan mark %x %y} bind Listbox {%W scan dragto %x %y} bind Scrollbar { if $tk_strictMotif { set tk_priv(activeFg) [lindex [%W config -activeforeground] 4] %W config -activeforeground [lindex [%W config -foreground] 4] } } bind Scrollbar { if {$tk_strictMotif && ($tk_priv(buttons) == 0)} { %W config -activeforeground $tk_priv(activeFg) } } bind Scrollbar {incr tk_priv(buttons)} bind Scrollbar {incr tk_priv(buttons) -1} bind Scale { if $tk_strictMotif { set tk_priv(activeFg) [lindex [%W config -activeforeground] 4] %W config -activeforeground [lindex [%W config -sliderforeground] 4] } } bind Scale { if {$tk_strictMotif && ($tk_priv(buttons) == 0)} { %W config -activeforeground $tk_priv(activeFg) } } bind Scale {incr tk_priv(buttons)} bind Scale {incr tk_priv(buttons) -1} bind Menubutton { set tk_priv(inMenuButton) %W if {[lindex [%W config -state] 4] != "disabled"} { if {!$tk_strictMotif} { %W config -state active } } } bind Menubutton { set tk_priv(inMenuButton) {} if {[lindex [%W config -state] 4] == "active"} { %W config -state normal } } bind Menubutton <1> {tk_mbButtonDown %W} bind Menubutton { if {($tk_priv(posted) == "%W") && ($tk_priv(inMenuButton) == "%W")} { [lindex [$tk_priv(posted) config -menu] 4] activate 0 } else { tk_mbUnpost } } bind Menubutton { set tk_priv(inMenuButton) %W if {[lindex [%W config -state] 4] != "disabled"} { if {!$tk_strictMotif} { %W config -state active } tk_mbPost %W } } bind Menubutton <2> { if {($tk_priv(posted) == "") && ([lindex [%W config -state] 4] != "disabled")} { set tk_priv(dragging) %W [lindex [$tk_priv(dragging) config -menu] 4] post %X %Y } } bind Menubutton { if {$tk_priv(dragging) != ""} { [lindex [$tk_priv(dragging) config -menu] 4] post %X %Y } } bind Menubutton {set tk_priv(dragging) ""} bind Menu {set tk_priv(window) %W; %W activate @%y} bind Menu {set tk_priv(window) {}; %W activate none} bind Menu {%W activate @%y} bind Menu {tk_invokeMenu %W} bind Menu <2> {set tk_priv(x) %x; set tk_priv(y) %y} bind Menu { if {$tk_priv(posted) == ""} { %W post [expr %X-$tk_priv(x)] [expr %Y-$tk_priv(y)] } } bind Menu { } bind Menu { } bind Menu {tk_mbUnpost} bind Menu {tk_traverseWithinMenu %W %A} bind Menu {tk_nextMenu -1} bind Menu {tk_nextMenu 1} bind Menu {tk_nextMenuEntry -1} bind Menu {tk_nextMenuEntry 1} bind Menu {tk_invokeMenu %W} bind Text <1> { set tk_priv(selectMode) char %W mark set insert @%x,%y %W mark set anchor insert if {[lindex [%W config -state] 4] == "normal"} {focus %W} } bind Text { set tk_priv(selectMode) word %W mark set insert "@%x,%y wordstart" tk_textSelectTo %W insert } bind Text { set tk_priv(selectMode) line %W mark set insert "@%x,%y linestart" tk_textSelectTo %W insert } bind Text {tk_textSelectTo %W @%x,%y} bind Text { tk_textResetAnchor %W @%x,%y tk_textSelectTo %W @%x,%y } bind Text {tk_textSelectTo %W @%x,%y} bind Text <2> {%W scan mark %y} bind Text {%W scan dragto %y} bind Text { if {"%A" != ""} { %W insert insert %A %W yview -pickplace insert } } bind Text {%W insert insert \n; %W yview -pickplace insert} bind Text {tk_textBackspace %W; %W yview -pickplace insert} bind Text {tk_textBackspace %W; %W yview -pickplace insert} bind Text {tk_textBackspace %W; %W yview -pickplace insert} bind Text {%W delete sel.first sel.last} bind Text { %W insert insert [selection get] %W yview -pickplace insert } tk_bindForTraversal Text set tk_priv(buttons) 0 set tk_priv(dragging) {} set tk_priv(focus) {} set tk_priv(grab) {} set tk_priv(inMenuButton) {} set tk_priv(posted) {} set tk_priv(selectMode) char set tk_priv(window) {} proc tkerror err { global errorInfo puts stdout "$errorInfo" } # Copyright (c) 1993 Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the Computer Systems # Engineering Group at Lawrence Berkeley Laboratory. # 4. Neither the name of the University nor of the Laboratory may be used # to endorse or promote products derived from this software without # specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#) $Header: wbi_subr.tcl,v 1.11 93/08/11 04:48:19 van Exp $ (LBL) option add WbImport.xid 0 startupFile option add WbImport.tmpfile /tmp/wbImport.ps startupFile option add WbImport.scanCommand doWbScan startupFile option add WbImport.xwdCommand doWbXwd startupFile option add WbImport.propName PSFILE startupFile set maxwbpage 0 set wb_request 0 set wborientation 0 set do_pagescan 1 proc fileInPath {f} { global env if {$f == ""} { return 0 } if {[string index $f 0] == "/"} { return [file executable $f] } foreach d [split $env(PATH) :] { if {[file executable $d/$f]} { return 1 } } return 0 } proc wbi_request {cmd} { global wbwindow prop_name wb_request if {$wb_request == 0} { set wb_request 1 setProperty $wbwindow $prop_name $cmd } } proc wbi_request_async {cmd} { global wbwindow prop_name wb_request if {$wb_request == 0} { setProperty $wbwindow $prop_name $cmd } } proc wbi_scan {} { global wbi_label tmpfile scan_command wborientation do_pagescan $wbi_label configure -text "Scanning..." update idletasks exec $scan_command -$wborientation > $tmpfile set do_pagescan 0 wbi_request_async "$tmpfile" $wbi_label configure -text "Ready" set do_pagescan -1 } proc wbi_xwd {} { global wbi_label tmpfile xwd_command wborientation do_pagescan $wbi_label configure -text "click on a window..." update idletasks exec $xwd_command -$wborientation > $tmpfile set do_pagescan 0 wbi_request_async "$tmpfile" $wbi_label configure -text "Ready" set do_pagescan -1 } proc wbi_file {n} { global wbifilelist wbifileslot if {$wbifileslot($n)} { wbi_request_async "#$wbifileslot($n)" } else { set cmd "[winfo id .] $n [.b.lb get $n] $wbifilelist($n)" wbi_request $cmd } } proc getNextPageName {n} { set cmd "[winfo id .] [expr 65537+$n] =$n" wbi_request $cmd } proc handleClientEvent {n slot} { global wb_request wbifilelist wbifileslot maxwbpage prop_name set wb_request 0 if {$n == 65536} { global wborientation set mp [expr $slot&0xffff] set wborientation [expr $slot>>16] if {$mp > $maxwbpage} { getNextPageName [expr $maxwbpage+1] set maxwbpage $mp } return } if {$n >= 65537} { set n [expr $n-65537] if {$slot>0} { set t [getProperty [winfo id .] $prop_name del] set l [addItemToFileList "$t ($slot)" /dev/null] set wbifileslot($l) $slot } if {$n < $maxwbpage} { getNextPageName [expr $n+1] } return } if {$slot} { if {$slot > $maxwbpage} { set maxwbpage $slot } set wbifileslot($n) $slot set t [.b.lb get $n] .b.lb delete $n .b.lb insert $n "$t ($slot)" .b.lb select from $n } else { puts stderr "-import of $wbifilelist($n) failed" } } proc wbi_quit {} { global tmpfile exec rm -f $tmpfile destroy . } proc fullPathName {f} { if {[file readable $f] == 0} { puts stderr "-wbimport: can't find file `$f'" } set d [file dirname $f] case $d in { . { set d [pwd] } ./* { set d [pwd]/$d } .. { set d [file dirname [pwd]] } ../* { set d [pwd]/$d } /* { } default { set d [pwd]/$d } } return $d/[file tail $f] } proc addItemToFileList {iname ifile} { global wbifilelist wbifileslot set i [.b.lb size] .b.lb insert end $iname set wbifilelist($i) [fullPathName $ifile] set wbifileslot($i) 0 return $i } proc makeFileList {fname} { set f [open $fname] for {set i 0} {[gets $f line]>0} {incr i 1} { if {[llength $line]>1} { addItemToFileList [lindex $line 0] [lindex $line 1] } else { if {[regexp -indices -nocase .ps\$ $line m]} { set n [string range $line 0 [expr [lindex $m 0]-1]] } else { set n $line } addItemToFileList $n $line } } close $f } # ask the server what page it's on & if it's higher than what we # expect, query it for page names. proc addCurrentPages {} { global do_pagescan if {$do_pagescan>0} { set cmd "[winfo id .] 65536 ?" wbi_request $cmd } else { if {$do_pagescan<0} { set do_pagescan 1 } } after 2000 addCurrentPages } proc makeFileListBox {} { global wbifilelist wbifileslot wbi_label frame .b scrollbar .b.lbscroll -relief sunken -command ".b.lb yview" listbox .b.lb -yscroll ".b.lbscroll set" -relief sunken -setgrid 1 \ -geometry 6x10 pack append .b \ .b.lbscroll {right filly} \ .b.lb {left expand fill} tk_listboxSingleSelect .b.lb bind .b.lb \ "wbi_file \[.b.lb curselection\]; adjustScroll" pack append . .b {bottom expand fill} pack after $wbi_label \ [button .f.next -text "Next" -command "nextFile"] {left padx 5 pady 5} } proc adjustScroll {} { set sb [.b.lbscroll get] if {[lindex $sb 0] > [lindex $sb 1]} { # box too big for window - we might need to adjust scrollbar # to keep selected item in the middle. set m [expr ([lindex $sb 1]+1)/2] if {$m > 1} { incr m -1 } set c [.b.lb curselection] if {$c >= [expr [lindex $sb 0]-$m]} { .b.lb yview [expr [lindex $sb 0]-[lindex $sb 1]+1] } else { if {$c >= $m} { .b.lb yview [expr $c-$m] } } } } proc nextFile {} { set c [.b.lb curselection] if {$c == ""} { set c -1 } incr c 1 if {$c < [.b.lb size]} { .b.lb select from $c wbi_file $c adjustScroll } } proc makeWin {} { global wbi_label scan_command xwd_command frame .f pack append . .f {top fill} set wbi_label .f.label pack append .f \ [label $wbi_label -text "Ready"] {bottom fillx} if {[fileInPath $scan_command]} { pack append .f \ [button .f.scan -text "Scan" -command "wbi_scan"] \ {left padx 5 pady 5} } if {[fileInPath $xwd_command]} { pack append .f \ [button .f.xwd -text "Xwin" -command "wbi_xwd"] \ {left padx 5 pady 5} } pack append .f \ [button .f.quit -text "Quit" -command "wbi_quit"] {left padx 5 pady 5} makeFileListBox } proc winChoice {wlist {w .wd}} { catch {destroy $w} toplevel $w frame $w.top frame $w.bot pack append $w $w.top {top fill expand} $w.bot {top fill expand} pack append $w.top \ [message $w.top.msg -justify center -text "Which wb?"] \ {top fill expand} foreach i $wlist { button $w.bot.$i -anchor w -text " $i ([getWindowName $i])" \ -command "global wbwindow; set wbwindow $i; destroy $w" pack append $w.bot $w.bot.$i {top fill expand padx 4 pady 8} } button $w.bot.cancel -text "Quit" \ -command "exit 1" pack append $w.bot $w.bot.cancel {top fill expand} grab set $w tkwait window $w } set wbwindow [option get . xid WbImport] if { $wbwindow == 0 } { set wbids [getWindowByClass wb] if {[llength $wbids] != 1} { if {[llength $wbids] == 0} { puts stderr "-wbimport: can't find an active `wb'" exit 1 } winChoice $wbids } else { set wbwindow [lindex $wbids 0] } } set wbwinname [getWindowName $wbwindow] if {$wbwinname != ""} { wm title . "wbi: $wbwinname" } set tmpfile [option get . tmpfile WbImport] set scan_command [option get . scanCommand WbImport] set xwd_command [option get . xwdCommand WbImport] set prop_name [option get . propName WbImport] makeWin proc wbi_run {f} { if {$f != "."} { makeFileList $f } addCurrentPages tkwait window . } $Header: /user6/ouster/wish/RCS/tkArgv.c,v 1.13 92/10/07 11:27:30 ouster Exp $ SPRITE (Berkeley)-_Print summary of command-line options and abortambiguous option "unrecognized argument "expected integer argument " but got "expected floating-point argument for "" but got "" option requires two following argumentsbad argument type %d in Tk_ArgvInfo" option requires an additional argument Command-specific options: Default value: Default value: Default value: " Generic options for all commands:$Header: /user6/ouster/wish/RCS/tkWindow.c,v 1.108 93/01/23 16:59:23 ouster Exp $ SPRITE (Berkeley)-T@nP-\@pp-d@r-l@-t@p-|@[-@-@ c<@-@s\-@vT-@y0-@zH-Ap-AS-Au`cHAS-AD-A-AS-A4-BcTBQ-Bepc`AS-BtclBp-B@cxAselectioncheckbuttonmenubuttonradiobuttonscrollbartopleveldisabledno display name and no $DISPLAY environment variablecouldn't connect to display "bad screen number "%d"window name starts with an upper-case letter: "window name "" already exists in parent%.100s #%dcouldn't generate unique name to register applicationTK_LIBRARY/usr/local/lib/tktk_librarytk_versiontkVersionbad window path name "Tk_DestroyWindow couldn't find child in parent (deleted twice?)bad window path name "$Header: /user6/ouster/wish/RCS/tkEvent.c,v 1.69 92/12/21 12:01:19 ouster Exp $ SPRITE (Berkeley)? @@WM_PROTOCOLSTk_CreatefileHandler can't handle file id %d$Header: /user6/ouster/wish/RCS/tkGet.c,v 1.5 92/08/10 09:02:46 ouster Exp $ SPRITE (Berkeley)bad anchor position "": must be n, ne, e, se, s, sw, w, nw, or centerunknown anchor positionbad join style "": must be bevel, miter, or roundunknown join styleprojectingbad cap style "": must be butt, projecting, or roundprojectingunknown cap stylebad justification "": must be left, right, center, or fillunknown justification stylebad screen distance "bad screen distance "$Header: /user6/ouster/wish/RCS/tkOption.c,v 1.25 92/03/16 08:46:14 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " cmd arg ?arg ...?"wrong # args: should be " add pattern value ?priority?"wrong # args: should be "wrong # args: should be " get window name class"readfilewrong # args: should be " readfile fileName ?priority?"bad option "": must be add, clear, get, or readfilewidgetDefaultstartupFileuserDefaultinteractivebad priority level "": must be widgetDefault, startupFile, userDefault, interactive, or a number between 0 and 100missing colon on line %dmissing value on line %dmissing newline on line %dcouldn't read file "couldn't stat file "error reading file "no RESOURCE_MANAGER property and no HOME envariable%s/.Xdefaults$Header: /user6/ouster/wish/RCS/tkCmds.c,v 1.43 93/02/04 11:23:18 ouster Exp $ SPRITE (Berkeley)bad option "": must be atom, atomname, cells, children, class, depth, exists, fpixels, geometry, height, id, interps, ismapped, name, parent, pathname, pixels, reqheight, reqwidth, rgb, rootx, rooty, screen, screencells, screendepth, screenheight, screenmmheight, screenmmwidth, screenvisual, screenwidth, toplevel, visual, vrootheight, vrootwidth, vrootx, vrooty, width, x, or ywrong # arguments: must be " window"can't invoke "" command: application has been destroyedwrong # args: should be " milliseconds ?command? ?arg arg ...?"bad milliseconds value "wrong # args: should be " window ?pattern? ?command?"wrong # args: should be " option ?arg?"colormodelwrong # args: should be " colormodel window ?mono|color?"monochromecan't treat screen as color: only 1 bit planemonochromebad color model "": must be color or monochromebad option "": must be colormodelwrong # args: should be " variable|visible|window name"variablevisibilitybad option "": must be variable, visibility, or windowidletasksbad argument "": must be idletaskswrong # args: should be " ?idletasks?"wrong # args: should be " option ?arg?"wrong # args: should be " atom name"atomnamewrong # args: should be " atomname id"?bad atom?no atom exists with id "childrenchildrencontainingwrong # args: should be " containing rootX rootY"wrong # args: should be " fpixels window number"geometrygeometry%dx%d+%d+%dwrong # args: should be " interps"ismappedismappedgeometrygeometrypathnamepathnamewindow id "" doesn't exist in this applicationwrong # args: should be " pixels window number"reqheightreqheightreqwidthreqwidthwrong # args: should be " rgb window colorName"%d %d %dscreencellsscreencellsscreendepthscreendepthscreenheightscreenheightscreenmmheightscreenmmheightscreenmmwidthscreenmmwidthscreenvisualscreenvisualpseudocolorgrayscaledirectcolortruecolorstaticcolorstaticgrayscreenwidthscreenwidthtopleveltoplevelpseudocolorgrayscaledirectcolortruecolorstaticcolorstaticgrayvrootheightvrootheightvrootwidthvrootwidth$Header: /user6/ouster/wish/RCS/tkFocus.c,v 1.4 93/02/03 10:02:23 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " default ?window?"wrong # args: should be "bad option "": must be default or none$Header: /user6/ouster/wish/RCS/tkGrab.c,v 1.29 92/12/12 16:17:28 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " ?-global? window" or " option ?arg arg ...?"wrong # args: should be " current ?window?"wrong # args: should be " release window"wrong # args: should be " set ?-global? window"bad argument "": must be " set ?-global? window"wrong # args: should be " status window"unknown or ambiguous option "": must be current, release, set, or statusgrab failed: another application has grabgrab failed: window not viewablegrab failed: keyboard or pointer frozengrab failed: invalid timegrab failed for unknown reason (code %d)$Header: /user6/ouster/wish/RCS/tkPack.c,v 1.33 93/02/04 14:55:40 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " option arg ?arg ...?"window "" isn't packedwindow "" isn't packed"pack before" couldn't find predecessor1122wrong # args: should be " info window"wrong # args: should be " unpack window"bad option "": must be after, append, before, or infobad frame factor in ArrangePackingwrong # args: window "" should be followed by optionscan't pack inside wrong # args: "" option must be followed by screen distancebad pad value "": must be positive screen distancewrong # args: "frame" option must be followed by anchor pointbad option "": should be top, bottom, left, right, expand, fill, fillx, filly, padx, pady, or frameUnlink couldn't find previous window$Header: /user6/ouster/wish/RCS/tkPlace.c,v 1.7 92/11/29 16:28:45 ouster Exp Locker: ouster $ SPRITE (Berkeley)wrong # args: should be " option|pathName argsconfigurewrong # args: should be " configure pathName option value ?option value ...?"wrong # args: should be " forget pathName"wrong # args: should be " info pathName"-relx %.4g -rely %.4g -relwidth %.4g -width %d -relheight %.4g -height %d -anchor -bordermode outside -bordermode ignorewrong # args: should be " slaves pathName"unknown or ambiguous option "": must be configure, forget, info, or slavesUnlinkSlave couldn't find slave to unlinkcan't use placer on top-level window ""; use wm command insteadextra option "" (option with no value?)-bordermodebad border mode "": must be ignore, inside, or outsidecan't place relative to -relheight-relwidthunknown or ambiguous option "": must be -anchor, -bordermode, -height, -in, -relheight, -relwidth, -relx, -rely, -width, -x, or -y$Header: /user6/ouster/wish/RCS/tkSelect.c,v 1.30 92/12/28 14:16:23 ouster Exp $ SPRITE (Berkeley)selection changed before it could be retrievedselection handler returned too many bytesselection doesn't exist or form "" not definedselection handler returned too many byteswrong # args: should be "%.50s option ?arg arg ...?"wrong # args: should be " clear window"too may args: should be "%.50s get ?type?"wrong # args: should be " handle window command ?type? ?format?"wrong # args: should be " own ?window? ?command?"bad option "%.50s": must be clear, get, handle, or ownMULTIPLETIMESTAMPCOMPOUND_TEXTAPPLICATIONWINDOW_NAMEselection doesn't exist or form "" not definedselection property too largebad format for string selection: wanted "8", got "%d"bad format for selection: wanted "32", got "%d"selection handler returned too many bytesselection property too largebad format for string selection: wanted "8", got "%d"bad format for selection: wanted "32", got "%d"selection handler returned too many bytes%s %d %dselection owner didn't respondAPPLICATION MULTIPLE TARGETS TIMESTAMP WINDOW_NAMEWaitForConfigureNotify finished, serial %d $Header: /user6/ouster/wish/RCS/tkWm.c,v 1.50 93/01/23 17:01:10 ouster Exp $ SPRITE (Berkeley)WaitForMapNotify finished AdjustPosition wanted %d,%d and got %d,%d AdjustPosition setting adjustments to %d and %d AdjustPosition moving to %d, %d bad geometry specifier "Tk_CoordsToWindow get False return from XTranslateCoordinatesTk_CoordsToWindow get error return from XQueryTreeUpdateVRootGeometry: x = %d, y = %d, width = %d, height = %d, status = %d Tk_MoveToplevelWindow called with non-toplevel windowWM_DELETE_WINDOWWM_PROTOCOLS (command for "" window manager protocol)couldn't unlink window in TkWmDeadWindowWM_DELETE_WINDOWwrong # args: should be " option window ?arg ...?"wrong # arguments: must be " tracing ?boolean?"window "" isn't a top-level windowwrong # arguments: must be " aspect window ?minNumer minDenom maxNumer maxDenom?"%d %d %d %daspect number can't be <= 0wrong # arguments: must be " client window ?name?"WM_CLIENT_MACHINEwrong # arguments: must be " command window ?value?"WM_COMMANDdeiconifywrong # arguments: must be " deiconify window"focusmodelwrong # arguments: must be " focusmodel window ?active|passive?"bad argument "": must be active or passivegeometrywrong # arguments: must be " geometry window ?newGeometry?"%dx%d%c%d%c%dwrong # arguments: must be " grid window ?baseWidth baseHeight widthInc heightInc?"%d %d %d %dbaseWidth can't be < 0baseHeight can't be < 0widthInc can't be < 0heightInc can't be < 0wrong # arguments: must be " group window ?pathName?"iconbitmapwrong # arguments: must be " iconbitmap window ?bitmap?"wrong # arguments: must be " iconify window"can't iconify "": override-redirect flag is setcouldn't send iconify message to window managericonmaskwrong # arguments: must be " iconmask window ?bitmap?"iconnamewrong # arguments: must be " iconname window ?newName?"iconpositionwrong # arguments: must be " iconposition window ?x y?"iconwindowwrong # arguments: must be " iconwindow window ?pathName?"wrong # arguments: must be " maxsize window ?width height?"wrong # arguments: must be " minsize window ?width height?"overrideredirectwrong # arguments: must be " overrideredirect window ?boolean?"positionfromwrong # arguments: must be " positionfrom window ?user/program?"bad argument "": must be program or userprotocolwrong # arguments: must be " protocol window ?name? ?command?"sizefromwrong # arguments: must be " sizefrom window ?user|program?"bad argument "": must be program or userwrong # arguments: must be " title window ?newTitle?"transientwrong # arguments: must be " transient window ?master?"withdrawwrong # arguments: must be " withdraw window"couldn't send withdraw message to window managerunknown or ambiguous option "": must be aspect, client, command, deiconify, focusmodel, geometry, grid, group, iconbitmap, iconify, iconmask, iconname, iconposition, iconwindow, maxsize, minsize, overrideredirect, positionfrom, protocol, sizefrom, title, trace, transient, or withdrawTopLevelEventProc: user changed %s size to %dx%d ConfigureEvent: %s x = %d y = %d, width = %d, height = %d send_event = %d, serial = %d winPtr coords %d,%d, wmPtr coords %d,%d __WM_ROOT__SWM_ROOT%s format %d numItems %d ReparentEvent got bogus VROOT property:ReparentEvent: %s reparented to 0x%x, vRoot = 0x%x TopLevelEventProc: %s deleted TopLevelEventProc: %s mapped TopLevelEventProc: %s unmapped UpdateGeometryInfo moving to %d %d, resizing to %d x %d, adjustments are %d and %d, inParent offset %d %d $Header: /user6/ouster/wish/RCS/tkButton.c,v 1.73 93/01/21 16:51:44 ouster Exp $ SPRITE (Berkeley)44CheckbuttonRadiobutton ,@T4( `t4(4<4<4444l 4$  ,84$4D4P444\lx5,55 55 5(50@@585<5D5L4<HT5T85\5d5l5t``l5x5x5555555d5555h 55550 555606p 6p 66 6(60 686@6H6P6T6\6d,8D6l6t6|6\-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-command-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforeground-Adobe-Helvetica-Bold-R-Normal--*-120-*-foregroundforegroundForeground-offvalueoffValue-onvalue-selectorselectorForeground-selectorselectorForeground-textvariabletextVariableVariable-variablevariableVariableselectedButton-variablevariableVariable`lconfigureactivate, configure, deactivate, flash, or invokeactivate, configure, deactivate, deselect, flash, invoke, select, or toggleactivate, configure, deactivate, deselect, flash, invoke, or selectwrong # args: should be " pathName ?options?"unknown button-creation command "%.50s"wrong # args: should be "%.50s option [arg arg ...]"activatewrong # args: should be "%.50s activate"configuredeactivatewrong # args: should be "%.50s deactivate"deselectwrong # args: should be "%.50s deselect"wrong # args: should be "%.50s flash"wrong # args: should be "%.50s invoke"wrong # args: should be "%.50s select"wrong # args: should be "%.50s select"bad option "%.50s": must be %sbad state value "": must be normal, active, or disabledwrong # args: should be " move tagOrId xAmount yAmount"$Header: /user6/ouster/wish/RCS/tkCanvas.c,v 1.39 93/01/21 16:51:52 ouster Exp $ SPRITE (Berkeley)postscriptwrong # args: should be " raise tagOrId ?aboveThis?"tagOrId "" doesn't match any itemswrong # args: should be " scale tagOrId xOrigin yOrigin xScale yScale"scale factors must be greater than zerowrong # args: should be " scan mark|dragto x y"bad scan option "AdAɬ": must be mark or dragto 0X6 7 7 7 Xd74 7@47D7L7T@ 7`7h7p<7777,  0T7d87l7l77t77t7h 7777 <P`7 p 7D 8D08H<Pd8 Hp8L8$L8,888@8H(4Dp-backgroundwrong # args: should be "background select option ?tagOrId? ?arg?"Backgroundcan't find an indexable and selectable item "-backgroundbackgroundwrong # args: should be "Background select adjust tagOrId index"borderWidthwrong # args: should be " select clear"background-borderwidthwrong # args: should be "borderWidth select from tagOrId index"BorderWidthwrong # args: should be "-closeenough select item"closeEnoughCloseEnoughwrong # args: should be "-confine select to tagOrId index"bad select option "": must be adjust, clear, from, item, or towrong # args: should be " type tag"wrong # args: should be " xview index"wrong # args: should be "-insertbackground yview index"insertBackgroundbad option "Foreground": must be addtag, bbox, bind, canvasx, canvasy, configure, coords, create, -insertborderwidthdchars, delete, dtag, find, focus, insertBorderWidthgettags, icursor, index, insert, itemconfigure, lower, BorderWidthmove, postscript, raise, scale, scan, select, type, xview, or yview-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOffTime-insertwidthinsertWidthInsertWidthbad scrollRegion "-scrollincrementscrollIncrementScrollIncrement-scrollregionscrollRegionScrollRegion-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-xscrollcommandxScrollCommandwrong # args: must be "ScrollCommand above tagOrId-yscrollcommandyScrollCommandwrong # args: must be "ScrollCommandwrong # args: must be " below tagOrIdwrong # args: must be " closest x y ?halo? ?start?can't have negative halo value "enclosedwrong # args: must be " enclosed x1 y1 x2 y2overlappingwrong # args: must be " overlapping x1 y1 x2 y2wrong # args: must be "wrong # args: should be " withtag tagOrId pathName ?options?"bad search command "": must be above, all, below, closest, enclosed, overlapping, or withtagwrong # args: should be " option ?arg arg ...?"wrong # args: should be " addtags tag searchCommand ?arg arg ...?" addtag tagwrong # args: should be " bbox tagOrId ?tagOrId ...?"%d %d %d %dwrong # args: should be " bind tagOrId ?sequence? ?command?" %d %d %d %d" doesn't exist %d %d %d %drequested illegal events; only key, button, motion, and enter/leave events may be usedwrong # args: should be " canvasx screenx ?gridspacing?"wrong # args: should be " canvasy screeny ?gridspacing?"configurewrong # args: should be " coords tagOrId ?x y x y ...?"wrong # args: should be " create type ?arg arg ...?"unknown or ambiguous item type "wrong # args: should be " dchars tagOrId first ?last?"wrong # args: should be " dtag tagOrId ?tagToDelete?"wrong # args: should be " find searchCommand ?arg arg ...?"wrong # args: should be " focus ?tagOrId?"wrong # args: should be " gettags tagOrId"wrong # args: should be " icursor tagOrId index"wrong # args: should be " index tagOrId string"can't find an indexable item "wrong # args: should be " insert tagOrId beforeThis string"itemconfigurewrong # args: should be " itemconfigure tagOrId ?option value ...?"wrong # args: should be " lower tagOrId ?belowThis?"" doesn't match any items$Header: /user6/ouster/wish/RCS/tkEntry.c,v 1.45 93/02/01 15:47:14 ouster Exp $ SPRITE (Berkeley)bad entry index "selection isn't in entrysel.firstsel.last 9`  9h9p$9t0<LX9| 9999dx9|9999(9, 9D(<P9L\p9L99T99P9H 99:: $ (<P:4 \p:4:$8:(8  :,<,@T:4<:<:D:L:T`p:\:d:l:t`-background %d %d %d %dbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-exportselectionexportSelectionExportSelectionforeground-Adobe-Helvetica-Medium-R-Normal--*-120-*-foregroundforegroundForeground-insertbackgroundinsertBackgroundForeground-insertborderwidthinsertBorderWidthBorderWidth-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOnTime-insertwidthinsertWidthInsertWidth-scrollcommandscrollCommandScrollCommand-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-textvariabletextVariableVariablewrong # args: should be " pathName ?options?"wrong # args: should be " option ?arg arg ...?"configurewrong # args: should be " delete firstIndex ?lastIndex?"wrong # args: should be "wrong # args: should be " icursor pos"wrong # args: should be " index string"wrong # args: should be " insert index text"wrong # args: should be " scan mark|dragto x"bad scan option "": must be mark or dragtotoo few args: should be " select option ?index?"wrong # args: should be " select clear"wrong # args: should be " select adjust index"wrong # args: should be " select from index"wrong # args: should be " select to index"bad select option "": must be adjust, clear, from, or towrong # args: should be " view index"bad option "": must be configure, delete, get, icursor, index, insert, scan, select, or viewbad state value "": must be normal or disabled$Header: /user6/ouster/wish/RCS/tkFrame.c,v 1.29 92/12/14 11:24:41 ouster Exp $ SPRITE (Berkeley) ; (4@;;L;Xdt; ;;$;,($;4;<;D;L ;P;X;`;h;p;x;;-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-geometrygeometryGeometrywrong # args: should be " pathName ?options?"Toplevelwrong # args: should be " option ?arg arg ...?"configurebad option "": must be configurebad geometry "": expected widthxheight %d %d %d %d$Header: /user6/ouster/wish/RCS/tkListbox.c,v 1.62 93/01/21 16:51:48 ouster Exp $ SPRITE (Berkeley) %d %d %d %d Ŵ; ;;;$0; ;;;|<P`;h;p;;<| ƤưƼ<$<< << <(<0 <8,  4H<@,Th|>Ӥ(>,>\ $> H0<H>(H-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeborderwidthactiveBorderWidthBorderWidth-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforeground-Adobe-Helvetica-Bold-R-Normal--*-120-*-foregroundforegroundForeground-postcommandpostCommand-selectorselectorForeground-selectorselectorForegroundwrong # args: should be " pathName ?options?"wrong # args: should be " option ?arg arg ...?"activatewrong # args: should be " activate index"wrong # args: should be " add type ?options?"checkbuttonradiobuttonseparatorbad menu entry type "": must be cascade, checkbutton, command, radiobutton, or separatorconfigurewrong # args: should be " delete first ?last?"wrong # args: should be " disable index"wrong # args: should be " enable index"entryconfigurewrong # args: should be " entryconfigure index ?option value ...?"wrong # args: should be " index string"wrong # args: should be " invoke index"wrong # args: should be " post x y"wrong # args: should be " unpost"ypositionwrong # args: should be " yposition index"bad option "": must be activate, add, configure, delete, disable, enable, entryconfigure, index, invoke, post, unpost, or ypositionbad state value "": must be normal, active, or disabled$Header: /user6/ouster/wish/RCS/tkMenubutton.c,v 1.37 93/01/21 16:51:57 ouster Exp Locker: ouster $ SPRITE (Berkeley) H\p>, |ܐܤ>,ܰ>@ >@>>>>p $0>( <HT>(?`?l??? x݈ݔ? 0 ?$?,?4tݠݴ?<DD?D?H?P?X$8LXd?`<?h?p?x?d??? ????h????l ????4???@$@ @@@$pހސޜި޴@(@,@4@<@D`-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforeground-Adobe-Helvetica-Bold-R-Normal--*-120-*-foregroundforegroundForeground-textvariabletextVariableVariable-underlineunderlineUnderlinewrong # args: should be " pathName ?options?"Menubuttonwrong # args: should be " option ?arg arg ...?"activatewrong # args: should be " activate"configuredeactivatewrong # args: should be " deactivate"bad option "": must be activate, configure, or deactivatebad state value "": must be normal, active, or disabled$Header: /user6/ouster/wish/RCS/tkMessage.c,v 1.37 92/12/14 11:17:44 ouster Exp $ SPRITE (Berkeley)@`@h@p@x8@@@@@  @ $0@@<@HTdp@ @@@P@|@@@$@( @@LAA AA0AA$A,A04 A4A<ADAL ATA\AdAl ApAxAA<-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidthforeground-Adobe-Helvetica-Bold-R-Normal--*-120-*-foregroundforegroundForeground-justify-textvariabletextVariableVariablewrong # args: should be " pathName ?options?"wrong # args: should be " option ?arg arg ...?"configurebad option "": must be configurecan't use "fill" justify style in messages$Header: /user6/ouster/wish/RCS/tkScale.c,v 1.31 92/12/16 11:59:16 ouster Exp $ SPRITE (Berkeley) AD AD  $A< 0<HA<ATA`l|A8AA$ AAAxAABBHBLBLB B(B0B8B<BDBL,BTB\BdBlXBpBxB BBBB\(4@Bh L`tB@ B@BdBBBB4B BBBBBBCC T-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-commandforeground-Adobe-Helvetica-Bold-R-Normal--*-120-*-foregroundforegroundForeground-foregroundforegroundForegroundvertical-showvalueshowValueShowValue-sliderforegroundsliderForegroundBackground-sliderforegroundsliderForegroundBackground-sliderlengthsliderLengthSliderLength-tickintervaltickIntervalTickIntervalwrong # args: should be " pathName ?options?"wrong # args: should be " option ?arg arg ...?"configurewrong # args: should be "wrong # args: should be " set value"bad option "": must be configure, get, or setverticalhorizontalbad orientation "": must be vertical or horizontalbad state value "": must be normal or disabled$Header: /user6/ouster/wish/RCS/tkScrollbar.c,v 1.39 93/01/21 16:51:27 ouster Exp $ SPRITE (Berkeley) 8L`C@4 lCH4 CP, CX,C`CdCh((ClCt C|CCpC4 @LXC0 dp|C0CCC CCCC<C C$CCCD-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-commandforeground-foregroundforegroundForeground-foregroundforegroundForegroundvertical-repeatdelayrepeatDelayRepeatDelay-repeatintervalrepeatIntervalRepeatIntervalwrong # args: should be " pathName ?options?"Scrollbarwrong # args: should be " option ?arg arg ...?"configurewrong # args: should be "%d %d %d %dwrong # args: should be " set totalUnits windowUnits firstUnit lastUnit"illegal totalUnits %dillegal windowUnits %dillegal lastUnit %dbad option "": must be configure, get, or setverticalhorizontalbad orientation "": must be vertical or horizontal$Header: /user6/ouster/wish/RCS/tkText.c,v 1.26 92/12/14 11:18:20 ouster Exp $ SPRITE (Berkeley)  ,D8 htD@DHDLDX D\DdDpDxh|DDDDD\DDDDD D<PdDpDDDDEEEEEEE E(E0E4 E8E@EHEP   4EX @ThE`tEhElEp$8ExDEEEEEEE|EEEEEEEEP`pd-backgroundbackgroundBackgroundTextFetchSelection couldn't find end of range-backgroundbackgroundBackgroundborderWidthbackgroundwrong # args: should be "-borderwidth mark option ?arg arg ...?"borderWidthBorderWidthwrong # args: should be " mark names"wrong # args: should be " mark set markName index"-exportselectionexportSelectionwrong # args: should be "ExportSelection mark unset markName ?markName ...?"can't delete "insert" markcan't delete "current" markforegroundbad mark option "": must be names, set, or unset*-Courier-Medium-R-Normal-*-120-*-foregroundforegroundForegroundwrong # args: should be " scan mark|dragto y"-insertbackgroundinsertBackgroundbad scan option "Foreground": must be mark or dragto-insertborderwidthinsertBorderWidthBorderWidth-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOnTime-insertwidthinsertWidthInsertWidth-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-setgrid-yscrollcommandyScrollCommandScrollCommandwrong # args: should be " pathName ?options?"disabledwrong # args: should be " option ?arg arg ...?"wrong # args: should be " compare index1 op index2"bad comparison operator "": must be <, <=, ==, >=, >, or !=configurewrong # args: should be " debug ?on|off?"wrong # args: should be " delete index1 ?index2?"wrong # args: should be " get index1 ?index2?"wrong # args: should be " index index"wrong # args: should be " insert index chars ?chars ...?"wrong # args: should be " yview ?-pickplace? lineNum|index"-pickplacebad option "": must be compare, configure, debug, delete, get, index, insert, mark, scan, tag, or yviewbad state value "": must be normal or disabledbad wrap mode "": must be char, none, or wordTk_DeleteBinding couldn't find on object listifonlyifbrokenbarTk_DeleteBinding couldn't find on hash chainidenticaldiaeresiscopyright$Header: /user6/ouster/wish/RCS/tkBind.c,v 1.55 93/01/29 10:40:23 ouster Exp $ SPRITE (Berkeley)includedinordfeminineincludesguillemotleftintersectionvoicedsoundsemivoicedsoundlogicalandkana_switchregisteredlogicalorArabic_commapartialderivativeArabic_semicolonfunctionArabic_question_markplusminusleftarrowArabic_hamzatwosuperiorTk_GetAllBindings overflowed bufferArabic_maddaonalefthreesuperiorrightarrowArabic_hamzaonalefdownarrowArabic_hamzaonwawArabic_hamzaunderalefparagraphTk_DeleteAllBindings couldn't find on hash chainsoliddiamondArabic_hamzaonyehperiodcenteredcheckerboardArabic_alefArabic_behonesuperiorArabic_tehmarbutamasculineArabic_tehguillemotrightArabic_thehonequarterArabic_jeem ,Gh  G| G GGG! G!GPGQGRGSHTH0UH@VHPWHXXHh`HxaHbHcHeHfHgHhHiHjHk$~%~%D%|I %I0IHIXIh&'I'8''(IIIIIIJJJ J(J4J@JXJlJpJtJJJJJJJJJJJKK KKK(K4KHK\KpK|KKKKKKKKKKKLLLL0L4L@LLLXLdLpLLLLLLLLMMMMM M(112 2HM@MPMXM`MpMxMMM M!4 "4X#M$M%4&54'5h(5)5*M+M,M-M.M/N 0N1N$2N03ND4NT5Nh6Nt7N8N9N:8;N<N=N>9,?O@OAO(BO<COLDOTEOhFOpGOHOIOJOKOLOMONOOOPOQORPSPTPUP0VPDWPXXPlYPxZ<[<\<]=(^=L_=t`PaPbPcPdPeQfQgQ(hQ,iQ8jQDkQPlQ\mQhnQtoQpQqQrQsQtQuQvQwQxQyQz@h{R|@}@~@@R@@ADRhF4@FF(GGG,G4pG@ ,D`G\  TGlGt G!(GG!GG"8"pHH("#HTH`HpH#H$$0$XHH$$HIIII(&I@&`I`Ip&II't'II(\(IIIJ)J**0J8JPJd**JxJ+8JJJJJJ,JJK-DKK K,K@KTKhKt-KK.TK.KKKKKKLLL(/L8LD00$LhL|LLLLLLL01MM1`1M012M82lMH22Mh343\333M4L4445(M5M5M6HM6N84N8XN<NLN`NpNNN8N8N9 NOO O4OD9O`9O|9OOO: ~:(:D;;;OPPP(P<PPPdPpPP<PPPPPPPPQQQ >@Q0Q<QHQTQ`QlQxQQQQQQQQQQQR RR R(R0R8RPRXR`FFFFFF~@d$DX8Tl  H t  !!!`!!!" ","`"|"""#8#p####$$ $H$p$$$%%4%l~%%&&4&P&&&'','d''($(P((()0)h)))*$*L*X*h***++,+T+t++,,0,|,,--8-d-|------. .(.@.p..../ /0/D/d//////00<0H0d0|00000001 181P1|112282`22223 3L3x334 484t4455T5556 646d6x68 8@8L8d8p8|888888899989H9T9`9l9x9999999:::8;;;<<$<@>0>`>>?4?H?X?h?x??????@@,@@@X@t@@@@@RHA8APF(FF4PxG$8G8   GH GL GP GT GX Gd  8  d    ! !P !p ! ! G G G H H H8 HH #, #d # # # # H H $< $d $ $ $ $ %( %` % % % I8 IP & & & I ' 'T ' ' ( (@ (| ( ( ) )X ) ) ) * *< JH J\ *x * * * + +D +d + + , , ,h , , - -$ -P -p - K8 KL K` - K - . .4 .` . . . . . / K /P /p L / / / LP L\ 00 Lt 0X 0p L L L L L 0 0 1 1, 1D 1l 1 1 1 2, 2T 2x 2 2 2 3 3@ 3h 3 3 3 4, 4d 4 4 5 5@ 5t 5 5 6 6( 6T~Arabic_hahthreequartersBackSpacelowrightcornerArabic_khahquestiondownuprightcornerArabic_dalLinefeed (command bound to event)upleftcornerArabic_thallowleftcornerArabic_raAcircumflexcrossinglinesArabic_zainhorizlinescan1Arabic_seenAdiaeresisbad ASCII character 0x%xhorizlinescan3Arabic_sheenhorizlinescan5Arabic_sadMulti_keyhorizlinescan7Arabic_dadCcedillaspecified button "horizlinescan9Arabic_tah" for non-button eventArabic_zahArabic_ainEcircumflexbad event type or keysym "Arabic_ghainEdiaeresisArabic_tatweelspecified keysym "Arabic_feh" for non-key eventArabic_qafIcircumflexno event type or button # or keysymArabic_kafIdiaeresismissing ">" in bindingem3spaceArabic_lamno events specified in bindingem4spaceArabic_meemno binding exists for "digitspaceArabic_noonpunctspaceArabic_hehthinspaceArabic_wawOcircumflexhairspaceArabic_alefmaksuraArabic_yehOdiaeresisArabic_fathatanmultiplysignifblankArabic_dammatanOobliqueellipsisArabic_kasratandoubbaselinedotArabic_fathaonethirdArabic_dammaUcircumflextwothirdsArabic_kasraUdiaeresisMode_switchonefifthArabic_shaddascript_switchtwofifthsArabic_sukunNum_LockNotifyAncestorthreefifthsArabic_switchKP_SpaceNotifyVirtualfourfifthsSerbian_djeNotifyInferioronesixthMacedonia_gjeKP_EnterNotifyNonlinearfivesixthsCyrillic_ioacircumflexNotifyNonlinearVirtualUkranian_jeNotifyPointerMacedonia_dseadiaeresisNotifyPointerRootleftanglebracketUkranian_iNotifyDetailNonedecimalpointUkranian_yiKP_EqualrightanglebracketSerbian_jeccedillaKP_MultiplySerbian_ljeoneeighthSerbian_njeKP_SeparatorBottomIfthreeeighthsSerbian_tsheecircumflexKP_SubtractOppositefiveeighthsMacedonia_kjeediaeresisKP_DecimalNotifyNormalseveneighthsByelorussian_shortuKP_DivideNotifyGrabtrademarkSerbian_dzeNotifyUngrabsignaturemarknumerosignicircumflexNotifyWhileGrabbedtrademarkincircleSerbian_DJEidiaeresisPlaceOnTopleftopentriangleMacedonia_GJEPlaceOnBottomrightopentriangleCyrillic_IOVisibilityUnobscuredemopencircleUkranian_JEVisibilityPartiallyObscuredemopenrectangleMacedonia_DSEVisibilityFullyObscuredleftsinglequotemarkUkranian_IocircumflexrightsinglequotemarkUkranian_YIleftdoublequotemarkSerbian_JEodiaeresisrightdoublequotemarkSerbian_LJEdivisionprescriptionSerbian_NJESerbian_TSHEMacedonia_KJElatincrossByelorussian_SHORTUucircumflexhexagramSerbian_DZEudiaeresisfilledrectbulletCyrillic_yuerrorInfofilledlefttribulletCyrillic_afilledrighttribulletCyrillic_beydiaeresisemfilledcircleCyrillic_tseemfilledrectCyrillic_de"tkerror" is an invalid command name or ambiguous abbreviationenopencircbulletCyrillic_ieenopensquarebulletCyrillic_efopenrectbulletCyrillic_gheopentribulletupCyrillic_hatkerror failed to handle background error. opentribulletdownCyrillic_iScedilla Original error: %s openstarCyrillic_shorti Error in tkerror: %s enfilledcircbulletCyrillic_kaenfilledsqbulletCyrillic_elfilledtribulletupCyrillic_emZabovedotfilledtribulletdownCyrillic_enleftpointerCyrillic_orightpointerCyrillic_peCyrillic_yaCyrillic_erCyrillic_esmaltesecrossCyrillic_teCyrillic_uscedilladoubledaggerCyrillic_zhecheckmarkCyrillic_veballotcrossCyrillic_softsigndoubleacutemusicalsharpCyrillic_yerumusicalflatCyrillic_zezabovedotmalesymbolCyrillic_shafemalesymbolCyrillic_etelephoneCyrillic_shchatelephonerecorderCyrillic_chephonographcopyrightCyrillic_hardsignCyrillic_YUsinglelowquotemarkCyrillic_AdoublelowquotemarkCyrillic_BECyrillic_TSEleftcaretCyrillic_DEOdoubleacuterightcaretCyrillic_IEdowncaretCyrillic_EFCyrillic_GHEUdoubleacuteCyrillic_HATcedilladowntackCyrillic_ICyrillic_SHORTIdownstileCyrillic_KAunderbarCyrillic_ELCyrillic_EMCyrillic_ENCyrillic_OCyrillic_PECyrillic_YAdownshoeCyrillic_ERodoubleacuterightshoeCyrillic_ESudoubleacuteleftshoeCyrillic_TElefttackCyrillic_UrighttackCyrillic_ZHEtcedillahebrew_alephCyrillic_VEabovedothebrew_bethCyrillic_SOFTSIGNControl_Lhebrew_gimmelCyrillic_YERUHcircumflexControl_Rhebrew_dalethCyrillic_ZEIabovedotCaps_Lockhebrew_heCyrillic_SHAShift_Lockhebrew_wawCyrillic_EJcircumflexhebrew_zayinCyrillic_SHCHAhebrew_hetCyrillic_CHEhcircumflexhebrew_tethCyrillic_HARDSIGNidotlesshebrew_yodGreek_ALPHAaccenthebrew_finalkaphGreek_EPSILONaccentjcircumflexhebrew_kaphGreek_ETAaccentCabovedothebrew_lamedGreek_IOTAaccentCcircumflexhebrew_finalmemGreek_IOTAdiaeresisGabovedothebrew_memGreek_IOTAaccentdiaeresisGcircumflexhebrew_finalnunGreek_OMICRONaccentquotedblhebrew_nunGreek_UPSILONaccentScircumflexnumbersignhebrew_samekhGreek_UPSILONdieresiscabovedothebrew_ayinGreek_UPSILONaccentdieresisccircumflexhebrew_finalpeGreek_OMEGAaccentgabovedotampersandhebrew_peGreek_alphaaccentgcircumflexquoterighthebrew_finalzadiGreek_epsilonaccentparenlefthebrew_zadiGreek_etaaccentscircumflexparenrighthebrew_kufGreek_iotaaccentasteriskhebrew_reshGreek_iotadieresisRcedillahebrew_shinGreek_iotaaccentdieresishebrew_tafGreek_omicronaccentLcedillaHebrew_switchGreek_upsilonaccentGreek_upsilondieresisGcedillaGreek_upsilonaccentdieresisNN(N4NHNXNlNxNNNNNNNNOOO,O@OPOX Ol Ot@O@OOOOOGreek_omegaaccentrcedillaGreek_ALPHAGreek_BETAlcedillaGreek_GAMMAGreek_DELTAGreek_EPSILONGreek_ZETAGreek_ETAGreek_THETAGreek_IOTAGreek_KAPPAEabovedotsemicolonGreek_LAMBDAGreek_MUNcedillaGreek_NUGreek_XIKcedillaquestionGreek_OMICRONGreek_PIGreek_RHOGreek_SIGMAGreek_TAUGreek_UPSILONeabovedotGreek_PHIGreek_CHIncedillaGreek_PSIGreek_OMEGAkcedillaGreek_alphaGreek_betaGreek_gammaGreek_deltaoverlineGreek_epsilonkana_fullstopGreek_zetakana_openingbracketODO;< <4 P P4 PH P\ < P| @P<= =4@=X==PPP=Q >>>L>tGreek_etakana_closingbracketGreek_thetakana_commaGreek_iotakana_middledotButtonPressGreek_kappaButtonReleaseGreek_lambdaColormapGreek_muGreek_nuGreek_xiGreek_omicronGreek_piFocusOutGreek_rhoGreek_sigmabracketleftGreek_finalsmallsigmabackslashKeyPressGreek_tauprolongedsoundbracketrightKeyReleaseGreek_upsilonasciicircumPropertyGreek_phiunderscoreResizeRequestGreek_chiquoteleftCirculateGreek_psiConfigureGreek_omegaGreek_switchleftradicaltopleftradicalReparenthorizconnectortopintegralVisibilitybotintegralCirculateRequestvertconnectorkana_SHIConfigureRequesttopleftsqbracketMapRequestbotleftsqbrackettoprightsqbracket @ @botrightsqbrackettopleftparensbotleftparenstoprightparensbotrightparensleftmiddlecurlybracerightmiddlecurlybracetopleftsummationbotleftsummationtopvertsummationconnectorbotvertsummationconnectortoprightsummationbotrightsummationrightmiddlesummationlessthanequalbraceleftnotequalgreaterthanequalbracerightintegralasciitildethereforenobreakspacevariationexclamdowninfinitysterlingTk_DeleteBinding couldn't find object table entryapproximatecurrencysimilarequal$Header: /user6/ouster/wish/RCS/tkSend.c,v 1.28 93/01/31 16:08:48 ouster Exp $ SPRITE (Berkeley)interpreter name cannot contain '|' characterinterpreter name "" is already in usewrong # args: should be " interpName arg ?arg ...?"no registered interpeter named "C %x %x %s|%scouldn't read intepreter registry propertyintepreter registry property is badly formedInterpRegistrybad property format for sent commandreceiver never heard of interpreter "%.40s"R %x %d %ssend to "%s" failed (no communication window)remote interpreter did not respond$Header: /user6/ouster/wish/RCS/tkAtom.c,v 1.7 92/11/13 16:32:47 ouster Exp $ SPRITE (Berkeley)?bad atom?$Header: /user6/ouster/wish/RCS/tkColor.c,v 1.22 93/01/21 16:51:47 ouster Exp $ SPRITE (Berkeley)unknown color name "no more colors left in colormap; changing screen's color model to monochrome (while allocating color "%.50s")invalid color name "no more colors left in colormap; changing screen's color model to monochrome (while allocating color in Tk_GetColorByValue)#%4x%4x%4xTk_FreeColor called with bogus color$Header: /user6/ouster/wish/RCS/tkGeometry.c,v 1.18 92/05/13 16:51:17 ouster Exp $ SPRITE (Berkeley)$Header: /user6/ouster/wish/RCS/tkPreserve.c,v 1.6 92/06/15 13:44:51 ouster Exp $ SPRITE (Berkeley)Tk_Release couldn't find reference for 0x%xTk_EventuallyFree called twice for 0x%x $Header: /user6/ouster/wish/RCS/tkError.c,v 1.10 92/04/12 17:02:08 ouster Exp $ SPRITE (Berkeley)Unknown display passed to Tk_CreateErrorHandler$Header: /user6/ouster/wish/RCS/tkBitmap.c,v 1.18 93/02/03 10:42:35 ouster Exp $ SPRITE (Berkeley)UUUUUUUUUUUUUUUU""""""""error reading bitmap file "bitmap "" not definedbitmap already registered in Tk_GetBitmapbitmap "" is already definedTk_NameOfBitmap received unknown bitmap argumentTk_SizeOfBitmap received unknown bitmap argumentTk_FreeBitmap called before Tk_GetBitmapTk_FreeBitmap received unknown bitmap argument$Header: /user6/ouster/wish/RCS/tk3d.c,v 1.33 92/12/14 11:24:56 ouster Exp $ SPRITE (Berkeley)bad relief type "%.50s": must be %sflat, raised, or sunkenunknown relief$Header: /user6/ouster/wish/RCS/tkConfig.c,v 1.32 92/12/16 09:59:31 ouster Exp $ SPRITE (Berkeley)value for "" missing (processing "%.40s" option) (%s "%.50s" in widget "%.50s")database entry for (%s "%.50s" in widget "%.50s")default value forambiguous option "unknown option "couldn't find synonym for option "bad config table: unknown type %d?? unknown type ??$Header: /user6/ouster/wish/RCS/tkFont.c,v 1.22 93/01/08 08:41:59 ouster Exp $ SPRITE (Berkeley)0123456789abcdefx\" doesn't existXFontStruct already registered in Tk_GetFontStructfont id 0x%xTk_FreeFontStruct called before Tk_GetFontStructTk_FreeFontStruct received unknown font argumentTkMeasureChars received unknown font argumentUnknown type %d in TkMeasureCharsTkDisplayChars received unknown font argumentUnknown type %d in TkDisplayChars$Header: /user6/ouster/wish/RCS/tkGC.c,v 1.11 92/12/14 11:18:09 ouster Exp $ SPRITE (Berkeley)GC already registered in Tk_GetGCTk_FreeGC called before Tk_GetGCTk_FreeGC received unknown gc argument$Header: /user6/ouster/wish/RCS/tkCursor.c,v 1.15 93/02/03 10:42:21 ouster Exp $ SPRITE (Berkeley)QSQQSQ Q QQQRR SSRSR$ R4"R@$S&T(RP*R`,Rl.Rx0R2T4T6T8T :T(<T0>T8@RBRDRFRHRJRLRNT@PRRTDTTLVTTXT\ZR\S^S`SbS(dS4fS@hSLjS\lSpnSpSrStTdvTlxTtzS|T|~TTSSSSTTSTTTTX_cursorbased_arrow_downbased_arrow_upbogositybottom_left_cornerbottom_right_cornerbottom_sidebottom_teebox_spiralcenter_ptrcoffee_mugcross_reversecrosshairdiamond_crossdouble_arrowdraft_largedraft_smalldraped_boxexchangeiron_crossleft_ptrleft_sideleft_teeleftbuttonll_anglelr_anglemiddlebuttonquestion_arrowright_ptrright_sideright_teerightbuttonrtl_logosailboatsb_down_arrowsb_h_double_arrowsb_left_arrowsb_right_arrowsb_up_arrowsb_v_double_arrowspraycantop_left_arrowtop_left_cornertop_right_cornertop_sideul_angleumbrellaur_anglebad cursor spec "invalid color name "invalid color name "couldn't load cursor fonterror reading bitmap file "bad hot spot in bitmap file "invalid color name "error reading bitmap file "source and mask bitmaps have different sizesinvalid color name "invalid color name "cursor already registered in Tk_GetCursorinvalid color name "invalid color name "cursor already registered in Tk_GetCursorFromDatacursor id 0x%xTk_FreeCursor called before Tk_GetCursorTk_FreeCursor received unknown cursor argument$Header: /user6/ouster/wish/RCS/tkCanvArc.c,v 1.8 92/12/16 16:59:05 ouster Exp $ SPRITE (Berkeley)TT`TxWUtU UXW|UWU HU(U0p-outline-stipplepiesliceU4CcVCfCdCi|CoHCt CzCC,Cwrong # args: should be "" create x1 y1 x2 y2 ?options?pieslice%g %g %g %gwrong # coordinates: expected 0 or 4, got %dbad -style option "": must be arc, chord, or pieslicematrix currentmatrix %g %g translate %g %g scale 0 0 1 %g %g arc closepath setmatrix 0 0 moveto 0 0 1 %g %g arc closepath setmatrix matrix currentmatrix %g %g translate %g %g scale 0 0 1 %g %g arc setmatrix %d setlinewidth 0 setlinecap $Header: /user6/ouster/wish/RCS/tkCanvBmap.c,v 1.7 92/12/16 16:59:15 ouster Exp $ SPRITE (Berkeley)UUH[4TUL[@UPUH-background-foregroundU`C`ZtClCtCdCC@C$CC8Cwrong # args: should be "" create x y ?options?wrong # coordinates: expected 0 or 2, got %d%g %g moveto %d 0 rlineto 0 %d rlineto %d %s 0 rlineto closepath%g %g translate %d %d true matrix { } imagemask $Header: /user6/ouster/wish/RCS/tkCanvLine.c,v 1.13 92/12/21 10:54:32 ouster Exp $ SPRITE (Berkeley)CÌCUUX^TU\\^`ULUUD^lUPUVp^xVt^HVHVV@-arrowshape-capstyle-joinstyle-splinesteps-stippleVxCp\CCpCCCCC@CpCwrong # args: should be "" create x1 y1 x2 y2 ?x3 y3 ...? ?options?too few coordinates for line: must have at least 4odd number of coordinates specified for linebad arrow spec "": must be none, first, last, or bothParseArrowShape received bogus offsetbad arrow shape "": must be list with three numbers%.5g %.5g %.5g%d setlinewidth 0 setlinecap 1 setlinecap 2 setlinecap 0 setlinejoin 1 setlinejoin 2 setlinejoin $Header: /user6/ouster/wish/RCS/tkRectOval.c,v 1.18 92/12/16 16:59:23 ouster Exp $ SPRITE (Berkeley)Vp`aVx\adVHVVX-outline-stippleb@pCpaCCϴCxCԐCCلCCCހrectangleVpCpaCCϴCxCԐC$CۄCCCހwrong # args: should be "" create x1 y1 x2 y2 ?options?%g %g %g %gwrong # coordinates: expected 0 or 4, got %d%g %g moveto %g 0 rlineto 0 %g rlineto %g 0 rlineto closepath matrix currentmatrix %g %g translate %g %g scale 1 0 moveto 0 0 1 0 360 arc setmatrix %d setlinewidth 0 setlinejoin 2 setlinecap $Header: /user6/ouster/wish/RCS/tkCanvPoly.c,v 1.10 92/12/16 16:59:21 ouster Exp $ SPRITE (Berkeley)VV<VVHeVLe@VH-splinesteps-stippleVPCDdHCHCC`CdCpCdCCPCwrong # args: should be "" create x1 y1 x2 y2 x3 y3 ?x4 y4 ...? ?options?too few coordinates for polygon: must have at least 6odd number of coordinates specified for polygon$Header: /user6/ouster/wish/RCS/tkCanvText.c,v 1.19 93/01/07 17:29:34 ouster Exp $ SPRITE (Berkeley)VVPWWdWg` gWXghW HW(W04W4W<T-Adobe-Helvetica-Bold-R-Normal--*-120-*-justify-stippleW@CpfCCCCDHD<D DDDlD D CDxwrong # args: should be "" create text x y [options]wrong # coordinates: expected 0 or 2, got %dbad index "selection isn't in itemsel.firstsel.last%g %g [ ] %d %s %s %s () false DrawText $Header: /user6/ouster/wish/RCS/tkCanvWind.c,v 1.6 92/12/14 11:29:53 ouster Exp $ SPRITE (Berkeley)WWTWWPWHWWLXHX`D`iDlDtDD$D(D,D@DPwrong # args: should be "" create x y ?options?wrong # coordinates: expected 0 or 2, got %dcan't use in a window item of this canvas$Header: /user6/ouster/wish/RCS/tkCanvPs.c,v 1.7 93/02/10 13:56:34 ouster Exp $ SPRITE (Berkeley)mtX LmX$PX(X0XmX4HX8X@ mXD@mXH4mXL0XPXXX\XdXhXpDXtX|XXXX-colormap-colormode-fontmap-pageanchor-pageheight-pagewidthmonochromebad color mode "": must be monochrome, gray, or colorcouldn't write file "%!PS-Adobe-3.0 EPSF-3.0 %%Creator: Tk Canvas Widget %%Title: Window %%CreationDate: %d %d %d %d%d %d %d %d%%BoundingBox: %%Pages: 1 %%DocumentData: Clean7Bit %%Orientation: Landscape Portrait %%DocumentNeededResources: font %%+ font %%EndComments tk_librarycouldn't find library directory: tk_library variable doesn't exist%.350s/prolog.ps/usr/local/lib/tkcouldn't open prolog file "error reading prolog file "/usr/local/lib/tk/prolog.ps: /CL %d def %%BeginSetup %%IncludeResource: font %%EndSetup %%Page: 1 1 %.1f %.1f translate 90 rotate %.4g %.4g scale %d %d translate %d %g moveto %d %g lineto %d %g lineto %d %g lineto closepath clip newpath (generating Postscript for item %d)grestore restore showpage %%Trailer end %%EOF %.3f %.3f %.3f setrgbcolor AdjustColor bad font map entry for " findfont scalefont setfont findfont scalefont setfont couldn't translate font name "" to Postscript StippleFill %g %g moveto %g %g lineto bad distance "$Header: /user6/ouster/wish/RCS/tkTextBTree.c,v 1.17 92/10/01 13:59:46 ouster Exp $ SPRITE (Berkeley)TkBTreeFindLine ran out of nodesTkBTreeFindLine ran out of linesTkBTreeLineIndex couldn't find lineTkBTreeLineIndex couldn't find nodeTkBTreeNextTag found incorrect tag summary info.TkBTreeCheck found odd toggle count for "%s" (%d)ChangeNodeToggleCount: negative toggle countChangeNodeToggleCount: negative delta, no tag entryCheckNodeConsistency found bad child count (%d)CheckNodeConsistency found line that %sdidn't point to parentCheckNodeConsistency found line with extra newlineCheckNodeConsistency found line with bad numBytesCheckNodeConsistency found line with no newlineCheckNodeConsistency found %s (%d %d)out-of-order tag indicesCheckNodeConsistency found line %stag with no node tag: %sCheckNodeConsistency found %s (%s)node tag with no parent tagCheckNodeConsistency found node that %sdidn't point to parentCheckNodeConsistency found level mismatch (%d %d)CheckNodeConsistency found mismatch in numChildren (%d %d)CheckNodeConsistency found mismatch in numLines (%d %d)CheckNodeConsistency found mismatch in toggleCount (%d %d)CheckNodeConsistency found duplicated node tag: %s$Header: /user6/ouster/wish/RCS/tkTextDisp.c,v 1.28 93/01/23 17:41:41 ouster Exp $ SPRITE (Berkeley) %d %d %d %dDisplayText received unknown exposure eventFindDLine reached end of textTkTextCharAtLoc ran out of lines$Header: /user6/ouster/wish/RCS/tkTextTag.c,v 1.5 92/12/16 09:59:41 ouster Exp $ SPRITE (Berkeley) yyyY y Yy YYzY$-background-bgstipple-borderwidth-fgstipple-foreground-underlinewrong # args: should be " tag option ?arg arg ...?"wrong # args: should be " tagName index1 ?index2?"wrong # args: should be " tag bind tagName ?sequence? ?command?"requested illegal events; only key, button, motion, and enter/leave events may be usedconfigurewrong # args: should be " tag configure tagName ?option? ?value? ?option value ...?"wrong # args: should be " tag delete tagName tagName ..."can't delete selection tagwrong # args: should be " tag lower tagName ?belowThis?"wrong # args: should be " tag names ?index?"nextrangewrong # args: should be " tag nextrange tagName index1 ?index2?"wrong # args: should be " tag raise tagName ?aboveThis?"wrong # args: should be " tag ranges tagName"bad tag option "": must be add, bind, configure, delete, lower, names, nextrange, raise, ranges, or remove" isn't defined in text widget$Header: /user6/ouster/wish/RCS/tkTextIndex.c,v 1.2 92/07/16 16:32:26 ouster Exp $ SPRITE (Berkeley)bad text index "": no such line in texttext doesn't contain any characters tagged with "bad text index "linestartwordstart$Header: /user6/ouster/wish/RCS/tkTrig.c,v 1.10 92/12/14 11:21:11 ouster Exp $ SPRITE (Berkeley)%g %g moveto %g %g %g %g %g %g curveto %g %g moveto %g %g %g %g %g %g curveto $Header: /user6/ouster/tcl/RCS/tclUtil.c,v 1.66 92/10/21 16:12:01 ouster Exp $ SPRITE (Berkeley)list element in braces followed by "%.*s" instead of spacelist element in quotes followed by "%.*s" %sinstead of spaceunmatched open brace in listunmatched open quote in listinternal error in Tcl_SplitListerrorCodebad index "": must be integer or "end"couldn't compile regular expression pattern: $Header: /user6/ouster/tcl/RCS/tclBasic.c,v 1.133 92/08/21 15:45:32 ouster Exp $ SPRITE (Berkeley)ZE/ ZE1ZEZEZEZE\E|ZEZEZEZEZEZEtZE=dZEZEZETZE[E0T[E[E˜[E[ Eh[(EdhE[0Eը[8E֨[@Eא[HEp[PE4[XE[`E8[hE[pE,[tEl[|E([E<[E.[Eh[E@[F[F[F[F d[F [F [F p[F[FD[EX[F"x[F'[F'\F*H\F-t\F/\F/\ F0continuelreplacetoo many nested calls to Tcl_Eval (infinite loop?)invalid command name: "invoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %d while executing "%.*s%s" invoked from within "%.*s%s"errorInfoerrorCodeerrorInfo$Header: /user6/ouster/tcl/RCS/tclHash.c,v 1.10 92/08/21 14:13:20 ouster Exp $ SPRITE (Berkeley)malformed bucket chain in Tcl_DeleteHashEntry%d entries in table, %d buckets number of buckets with %d entries: %d number of buckets with more %d or more entries: %d average search distance for entry: %.1fcalled Tcl_FindHashEntry on deleted tablecalled Tcl_CreateHashEntry on deleted table$Header: /user6/ouster/tcl/RCS/tclVar.c,v 1.29 93/01/29 11:33:05 ouster Exp $ SPRITE (Berkeley)no such variablevariable is arrayvariable isn't arrayno such element in arraytrace is active on variablewrong # args: should be " varName ?newValue?"wrong # args: should be " varName ?varName ...?"wrong # args: should be " varName value ?value ...?"wrong # args: should be " varName value ?value ...?"wrong # args: should be " option arrayName ?arg ...?"" isn't an arraywrong # args: should be " anymore arrayName searchId"donesearchwrong # args: should be " donesearch arrayName searchId"wrong # args: should be " names arrayName"nextelementwrong # args: should be " nextelement arrayName searchId"wrong # args: should be " size arrayName"startsearchwrong # args: should be " startsearch arrayName"bad option "": should be anymore, donesearch, names, nextelement, size, or startsearchwrong # args: should be " varName ?varName ...?"variable "" already existswrong # args: should be " ?level? otherVar localVar ?otherVar localVar ...?"variable "" already existsillegal search identifier "search identifier "" isn't for variable "couldn't find search "DeleteArray found searches on array alement!$Header: /user6/ouster/tcl/RCS/panic.c,v 1.3 91/10/10 11:25:51 ouster Exp $ SPRITE (Berkeley)$Header: /user6/ouster/tcl/RCS/tclGlob.c,v 1.26 92/12/23 11:33:18 ouster Exp $ SPRITE (Berkeley)unmatched open-brace in file namecouldn't read directory "%s%s%.*scouldn't find HOME environment variable to expand "" doesn't existwrong # args: should be " ?-nocomplain? name ?name ...?"-nocomplainno files matched glob pattern$Header: /user6/ouster/tcl/RCS/tclGet.c,v 1.11 92/02/29 16:13:14 ouster Exp $ SPRITE (Berkeley)expected integer but got "expected floating-point number but got "expected boolean value but got "$Header: tclUnixUtil.c,v 1.2 93/03/09 02:13:48 van Exp $ SPRITE (Berkeley)couldn't read file "couldn't stat file "error in reading file "error closing file " (file "%.150s" line %d)Tcl_Detach couldn't find processillegal use of | in commandcan't specify "" as last word in commanddidn't specify command to execute/tmp/tcl.in.XXXXXX/tmp/tcl.in.XXXXXXcouldn't create input file for command: couldn't write file input for command: couldn't reset or remove input file for command: couldn't read file "couldn't create input pipe for command: couldn't write file "couldn't create output pipe: /tmp/tcl.err.XXXXXX/tmp/tcl.err.XXXXXXcouldn't create error file for command: couldn't remove error file for command: couldn't create pipe: couldn't fork child process: forked process couldn't set up input/output couldn't find "%.150s" to execute bad file identifier "" isn't open$Header: /user6/ouster/tcl/RCS/tclParse.c,v 1.25 93/01/06 15:23:03 ouster Exp $ SPRITE (Berkeley)missing %cmissing close-bracemissing close-bracketextra characters after close-quoteextra characters after close-bracemissing close-brace for variable name (parsing index for array "%.*s")NULL argumentregexp too bigout of spacetoo many ()unmatched ()unmatched ()junk on end*+ operand could be emptynested *?+invalid [] rangeunmatched []internal urp?+* follows nothingtrailing \^$.[()|?+*\internal disasterNULL parametercorrupted programmemory corruptioncorrupted pointersinternal foulup$Header: /user6/ouster/tcl/RCS/tclCmdAH.c,v 1.79 93/01/29 14:36:00 ouster Exp $ SPRITE (Berkeley)wrong # args: should be "wrong # args: should be " string ?in? patList body ... ?default body?"extra case pattern with no body ("%.50s" arm line %d)wrong # args: should be " command ?varName?"couldn't save command result in variablewrong # args: should be " arg ?arg ...?"wrong # args: should be "wrong # args: should be " message ?errorInfo? ?errorCode?"errorCodewrong # args: should be " arg ?arg ...?" ("eval" body line %d)wrong # args: should be " expression"wrong # args: should be " start test next command" ("for" initial command) ("for" body line %d) ("for" loop-end command)wrong # args: should be " varName list command"couldn't set loop variable ("foreach" body line %d)wrong # args: should be " formatString ?arg arg ...?"format string ended in middle of field specifierbad field specifier "%c"not enough arguments for all format specifiers$Header: /user6/ouster/tcl/RCS/tclCmdIL.c,v 1.89 93/01/22 15:17:42 ouster Exp $ SPRITE (Berkeley)wrong # args: no expression after "" argumentwrong # args: no script following "" argumentwrong # args: no script following "else" argumentwrong # args: should be " varName ?increment?" (reading value of variable to increment) (reading increment)wrong # args: should be " option ?arg arg ...?"wrong # args: should be " args procname"" isn't a procedurewrong # args: should be " body procname"cmdcountwrong # args: should be " cmdcount"commandswrong # args: should be " commands [pattern]"completewrong # args: should be " complete command"wrong # args: should be " default procname arg varname"procedure "" doesn't have an argument "couldn't store default value in variable "wrong # args: should be " exists varName"wrong # args: should be " globals [pattern]"bad level "wrong # args: should be " level [number]"wrong # args: should be " library"TCL_LIBRARY/usr/local/lib/tclwrong # args: should be " locals [pattern]"wrong # args: should be " procs [pattern]"wrong # args: should be " script"tclversionwrong # args: should be " tclversion"wrong # args: should be " vars [pattern]"bad option "": should be args, body, cmdcount, commands, complete, default, exists, globals, level, library, locals, procs, script, tclversion, or varswrong # args: should be " list ?joinString?"wrong # args: should be " list index"wrong # args: should be " list index element ?element ...?"wrong # args: should be " arg ?arg ...?"wrong # args: should be "wrong # args: should be " list first last"expected integer or "end" but got "wrong # args: should be " list first last ?element element ...?"first index must not be greater than secondlist doesn't contain element wrong # args: should be " list pattern"wrong # args: should be "$Header: /user6/ouster/tcl/RCS/tclProc.c,v 1.60 92/09/14 15:42:07 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " name args body"too many fields in argument specifier "procedure "" has argument with no namealready at top levelbad level "wrong # args: should be " ?level? command ?arg ...?" ("uplevel" body line %d)no value given for parameter "called "" with too many arguments (procedure "%.50s" line %d)invoked "break" outside of a loopinvoked "continue" outside of a loop$Header: /user6/ouster/tcl/RCS/tclCmdMZ.c,v 1.18 93/01/29 09:40:49 ouster Exp $ SPRITE (Berkeley)wrong # args: should be " ?-nocase? exp string ?matchVar? ?subMatchVar subMatchVar ...?"-indiceserror while matching pattern: too many substring variablescouldn't set variable "wrong # args: should be " ?-nocase? ?-all? exp string subSpec varName"error while matching pattern: couldn't set variable "wrong # args: should be " oldName newName"can't delete "": command doesn't existcan't rename to "": command already existscan't rename "": command doesn't existwrong # args: should be " ?value?"wrong # args: should be " string format ?varName varName ...?"too many fields to scanfield width may not be specified in %c conversionbad scan conversion character "%c"different numbers of variable names and field specifierscouldn't set variable "wrong # args: should be " string ?splitChars?"wrong # args: should be " option arg ?arg ...?"wrong # args: should be " compare string1 string2"wrong # args: should be " first string1 string2"wrong # args: should be " index string charIndex"wrong # args: should be " last string1 string2"wrong # args: should be " length string"wrong # args: should be " match pattern string"wrong # args: should be " range string first last"expected integer or "end" but got "wrong # args: should be " tolower string"wrong # args: should be " toupper string"wrong # args: should be " string ?chars?"trimlefttrimlefttrimrighttrimrightbad option "": should be compare, first, index, last, length, match, range, tolower, toupper, trim, trimleft, or trimrighttoo few args: should be " option [arg arg ...]"variablewrong # args: should be " variable name ops command"wrong # args: should be " vdelete name ops command"wrong # args: should be " vinfo name"bad option "": should be variable, vdelete, or vinfobad operations "": should be one or more of rwuaccess disallowed by trace commandwrong # args: should be " test command" ("while" body line %d)" wasn't opened for readingnonewlinebad argument "": should be "nonewline"$Header: /user6/ouster/tcl/RCS/tclUnixAZ.c,v 1.40 93/01/28 16:06:35 ouster Exp $ SPRITE (Berkeley)error reading "wrong # args: should be " fileId offset ?origin?"bad origin "": should be start, current, or enderror during seek: wrong # args: should be " fileName"wrong # args: should be "wrong # args: should be " dirName" fileId"wrong # args: should be "couldn't change working directory to " command ?count?" ("time" body line %d)wrong # args: should be "%.0f microseconds per iteration fileId"error waiting for process to exit: error closing "CHILDSTATUSerror closing "CHILDKILLEDchild killed: wrong # args: should be "CHILDSUSP fileId"child suspended: child wait status didn't make sense error reading stderr output file: error reading from output pipe: wrong # args: should be " ?returnCode?"wrong # args: should be " option name ?arg ...?"wrong # args: should be "rootnamerootnameextensionextensionreadablereadablewritablewritableexecutableexecutableisdirectoryisdirectorywrong # args: should be " lstat name varName"couldn't lstat "readlinkreadlinkcouldn't readlink "wrong # args: should be " stat name varName"couldn't stat "bad option "": should be atime, dirname, executable, exists, extension, isdirectory, isfile, lstat, mtime, owned, readable, readlink, root, size, stat, tail, type, or writabledirectorycharacterSpecialblockSpecialwrong # args: should be " fileId"" wasn't opened for writingerror flushing "wrong # args: should be " fileId ?varName?"" wasn't opened for readingerror reading "wrong # args: should be " filename ?access?"illegal access mode "couldn't open "can't read output from command: standard output was redirectedcan't write input to command: standard input was redirectedTcl_OpenCmd found file already openwrong # args: should be "error getting working directory name: -nonewlinewrong # args: should be "" ?-nonewline? ?fileId? stringnonewlinebad argument "": should be "nonewline"" wasn't opened for writingerror writing "wrong # args: should be " fileId ?numBytes?" or " ?-nonewline? fileId"-nonewline$Header: /user6/ouster/tcl/RCS/tclEnv.c,v 1.10 93/02/01 16:23:26 ouster Exp $ SPRITE (Berkeley)EnvTraceProc called with confusing argumentsEnvTraceProc couldn't find interpreter$Header: /user6/ouster/tcl/RCS/tclUnixStr.c,v 1.14 93/01/29 14:42:51 ouster Exp $ SPRITE (Berkeley)EADDRINUSEEADDRNOTAVAILEAFNOSUPPORTEALREADYECONNABORTEDECONNREFUSEDECONNRESETEDEADLOCKEDESTADDRREQEHOSTDOWNEHOSTUNREACHEINPROGRESSEL2NSYNCELIBEXECEMSGSIZEEMULTIHOPENAMETOOLONGENETDOWNENETRESETENETUNREACHENOPROTOOPTENOTCONNENOTEMPTYENOTSOCKENOTUNIQEOPNOTSUPPEPFNOSUPPORTEPROTONOSUPPORTEPROTOTYPEESHUTDOWNESOCKTNOSUPPORTETIMEDOUTETOOMANYREFSEWOULDBLOCKunknown errorSIGVTALRMSIGWINCHunknown signalalarm clockbus errorchild status changedcontinue after stopEMT instructionfloating-point exceptionillegal instructioninterruptinput/output possible on filekill signalwrite on pipe with no readersinput/output possible on fileprofiling alarmpower-fail restartquit signalsegmentation violationbad argument to system callsoftware termination signaltrace trapstop signal from ttybackground tty readbackground tty writeurgent I/O conditionuser-defined signal 1user-defined signal 2virtual time alarmwindow changedexceeded CPU time limitexceeded file size limitunknown signal$Header: /user6/ouster/tcl/RCS/tclExpr.c,v 1.36 92/08/16 13:25:34 ouster Exp $ SPRITE (Berkeley)  ffff f$f,f0f4f8f<f@fDfHfLfPfTfXf\f`fdfhflfpftfxf|ffffffloating-point value "" too small to representfloating-point value "" too large to representfloating-point value too small to representfloating-point value too large to representpoorly-formed floating-point valueunmatched parentheses in expression "unknown operator in expressiondivide by zerocan't have : operator without ? firstsyntax error in expression "can't use floating-point valuenon-numeric string as operand of "syntax error in expression "expression didn't have numeric valueexpression didn't have numeric valueexpression didn't have numeric value$Header: /user6/ouster/tcl/RCS/tclAssem.c,v 1.13 93/01/29 10:14:45 ouster Exp $ SPRITE (Berkeley)Xlib: resource ID allocation space exhausted! Xlib: sequence lost (0x%lx > 0x%lx) in reply type 0x%x! unknown errorno such errorXIO: fatal IO error %d (%s) on X server "%s" after %lu requests (%lu known processed) with %d events remaining. The connection was probably broken by a server shutdown or KillClient. XlibMessage%s: %s MajorCodeRequest Major code %dXRequest (%s) MinorCodeRequest Minor code %dXRequestValue 0x%xValue 0x%xAtomID 0x%xResourceIDResourceID 0x%xErrorSerialError Serial #%dCurrentSerialCurrent Serial #%dXlib: warning, client built for newer rev (%d) than server (%d)! Xlib: warning, client is protocol rev %d, server is rev %d! %s: connection to "%s" refused by server %s: WM_CHANGE_STATE#define %s %dstatic short %s = {static unsigned char %s = {static char %s = {/usr/tmp/shmtrans/usr/tmp/shmtrans_XShmInit: usvsema failed, errno = %d _XShmInit: uspsema syncsema2, errno = %d %s%s%d.%d/tmp/.X11-unix/XMakeSHMConnection: uspsema syncsema2,errno = %d ĘĤİļhPhXh`hh(4no errorBadRequestBadValueBadWindowBadPixmapBadCursorBadMatchBadDrawableBadAccessBadAllocBadColorBadIDChoiceBadLengthBadImplementationXProtoError/usr/lib/X11/XErrorDBErrorType.ErrorNumber? @    @@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_? 0@P`p!1AQaq"2BRbr#3CScs$4DTdt%5EUeu&6FVfv'7GWgw(8HXhx )9IYiy *:JZjz +;K[k{ ,N^n~/?O_oGGGGG@G GGG`GGGGGGGG@G GGG`GGGGGGGG@G GGG`GGGGGGGGG`GG@G GGGG@G@G@GGG٠G@GGGGGG G G G`G٠GG GGG`G`G`GGGGG@G GGG`GGGGGGG@GGGGG٠G@G@G@G`G`G`G GGG`G٠GG G G GGGGGG`GG@G GGGGGGGGG`GG@G GGGGGGGGG`GG@G GGG?????_XGetPixel_XPutPixel_XSetImage_XAddPixelBad image %s: %d found in routine: %s ERROR: unlock fd %d offset %d pid %dERROR: getlock fd %d offset %d pid %dTRACE: Process %d deleted as tid %d from arena %s (file lock gone) by process %dERROR:Attempt to clean tids in arena %s failedERROR:Pid %d in slot %d but pid %d owns lock! in arena %sERROR:Pid %d header 0x%x not in listERROR:Pid %d Attempt to check for tids in arena %s failedERROR:Could not get regular semaphore deviceTRACE: Process %d added as tid %d sfd %d arena %sERROR:No tids left in arena %s. Too many users? (max = %d)ERROR:Attempt to add pid %d to arena %s failedusinit:ERROR:Virtual Address 0x%x already in use process %dusinit:mmap failed @ 0x%xTRACE: Header size %d malloc arena size %dusinit:ERROR:unable to create usmalloc arenausinit:ERROR:unable to set options on usmalloc arenausinit:ERROR:failed to initialize headerusinit:ERROR:unable to allocate memory lockUSTRACEFILETRACE: Process %d already mapped to arena %susinit:ERROR:failed to add pid %d to arenausinit:ERROR:open on %s failedusinit:ERROR:file lock on %s failedTRACE: Process %d joining existing arena %s @ 0x%xusinit:ERROR:Version Mismatchusinit:ERROR:Virtual Address 0x%x already in use process %dusinit:ERROR:mmap failed @ 0x%xusinit:ERROR:joined arena's locktype doesn't match established locktypeTRACE: Process %d arena went empty during hardlock attachTRACE: Process %d creating new arena %s:locktype %d maxusers %d/dev/hl/hlock000TRACE: Process %d Initializing SOFTWARE LOCKSTRACE: Process %d Initializing HARDWARE LOCKSTRACE: Process %d usinit succeded for arena %s @ 0x%x/dev/usemacloneusinit:ERROR:Cannot open %s/dev/usemacloneusinit:ERROR:Cannot allocate device semaphoreTRACE: arena @ 0x%x gets semaphore device 0x%x sfd %d/dev/usemausinit:ERROR:Cannot open %s/dev/usemaTRACE: Process %d arena went empty while adding tidusinit:ERROR:Cannot attach to sema 0x%x current valid tid %duspsema:ERROR:sp 0x%x has been freed! pid %d uspsema:ERROR:sp 0x%x queue overflow pid %d Internal error in uscpsema! usfreesema:ERROR:sp 0x%x bad usptr_t 0x%x pid %d i@iDiLiTi\idilit/dev/usemacloneusopenpollsema:ERROR:pid %d cannot get new minorusopenpollsema:ERROR:pid %d cannot chg mode on new minorTRACE: usopenpollsema:tid %d pollsema @ 0x%x creates device 0x%x fd %d/dev/usemausopenpollsema:ERROR:cannot attach to existing minor 0x%xTRACE: usopenpollsema:tid %d pollsema @ 0x%x attaches device 0x%x fd %dusfindspfd:ERROR:pid %d sharing fd with pid %d but fd %d doesn't match! TRACE: giving auto-open to tid %d pollsema @ 0x%x gets fd %d%s:ERROR:no tid!for process %d%s:ERROR:block:pid %d tid %d fd %d%s:ERROR:no tid!for process %d%s:ERROR:unblock:pid %d tid %d fd %d @XAUTHORITY.Xauthority/.Xauthorityd d/dev/hl/hlock000usinit:ERROR:failed HL_AMNRTRACE: Hardlocks got minor number %dusinit:ERROR:failed HL_RGSZusinit:ERROR:Virtual Address 0x%x already in use process %dusinit:ERROR:Unable to map hlocks @ 0x%xTRACE: Attached hlocks at 0x%xusinit:ERROR:unable to alloc hlocksTRACE: attaching to hardlock group %sTRACE: unable to open lockfileusinit:ERROR:failed HL_RGSZusinit:ERROR:unable to map hlocksTRACE: attach hlockaddr is %xTRACE: detaching from hardlock group %susdetach:ERROR:unable to open lockfileusdetach:ERROR:failed HL_RGSZusdetach:ERROR:unable to unmap hlocksERROR:hardware locks: NO LOCKS LEFTERROR:unable to open hlockfile <%s>ERROR:unable to allocate hlocksDouble tripped on lock @ 0x%x by pid %d called from 0x%xUnset lock, but lock not locked. lock @ 0x%x pid %d called from 0x%xUnlocking lock that other process locked. lock @ 0x%x by pid %d called from 0x%x%s: LOCKDUMP at %#x (last owner = %d) lock held lock free lock meter: tries %d spins %d hits %d lock debug: owner pid %d %s: LOCKDUMP at %#x (last owner = %d) lock held lock free lock meter: tries %d spins %d hits %d lock debug: owner pid %d Double tripped on lock @ 0x%x by pid %d called from 0x%xussetlockUnset lock, but lock not locked. lock @ 0x%x pid %d called from 0x%xUnlocking lock that other process locked. lock @ 0x%x by pid %d called from 0x%xusunsetlockInternal error in uscsetlock! ussetlockusunsetlock ((((( H @  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASS/lib/chrclass//etc/passwdDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:/usr/sbin:/usr/bsd:/usr/bin:/binUnknown error: %dgetwd: can't stat /getwd: can't stat .getwd: can't open ..getwd: read error in ..getwd: read error in ..j 0HTp,DPdt ,DTl|,<Xx 8Ldx @Xl(4@\|Dl(Dd0Tt(Lh,<PtNo permission matchNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesResource temporarily unavailableNot enough spacePermission deniedBad addressBlock device requiredDevice or resource busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open files in a processInappropriate IOCTL operationText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageError 78Error 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyInvalid System CallError 89Error 90Error 91Error 92Error 93Error 94Error 95Error 96Error 97Error 98Error 99Error 100Operation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downHost is unreachableToo many levels of symbolic linksFile name too longDirectory not emptyDisc quota exceededStale NFS file handleToo many levels of remote in pathI(IIIHOSTRESORDERInfinityInfinity 000000000000000000000123456789ABCDEF0123456789abcdef+InfinityInfinity-Infinity+InfinityInfinity-Infinity``W`/Lw/K:/JMFw/k 0HTp,DPdt ,DTl|,<Xx 8Ldx @Xl(4@\|Dl(Dd0Tt(Lh   , < P t    No permission matchNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesResource temporarily unavailableNot enough spacePermission deniedBad addressBlock device requiredDevice or resource busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open files in a processInappropriate IOCTL operationText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageError 78Error 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyInvalid System CallError 89Error 90Error 91Error 92Error 93Error 94Error 95Error 96Error 97Error 98Error 99Error 100Operation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downHost is unreachableToo many levels of symbolic linksFile name too longDirectory not emptyDisc quota exceededStale NFS file handleToo many levels of remote in path/etc/hostsunexpected answer type %d, size %d size (%d) too big res_search failed %u.%u.%u.%u.in-addr.arpares_query failed LOCALDOMAIN/usr/etc/resolv.confnameservernameservernameserverhostresorderhostresorderhostresorderres_query(%s, %d, %d) res_query: mkquery failed res_query: send error rcode = %d, ancount=%d res_querydomain(%s, %s, %d, %d) %.*s.%.*sHOSTALIASES%Y %j %H %M %S %w%d %d %d %d %d %dres_mkquery(%d, %s, %d, %d) res_send() Querying server (# %d) address = %s socket (vc) failedconnect failedwrite failedread failedresponse truncated read failedsocket (dg) failedtimeout recvfromold answer: truncated answer got answer: usa_englishlllllllllllll<llllllHlT`lllllmmmmmlxm m(m,FebruarySeptemberNovemberDecemberWednesdayThursdaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %Z %Y%m/%d/%y%I:%M:%S %p%H:%M:%S/lib/cftime/LANGUAGE/lib/cftime//lib/cftime/mPmXm`mhmpmtmxm|mmmmmUPDATEDAUPDATEMAZONEINITmm4@mmmmmmmmmmmLSERVFAILNXDOMAINNOCHANGEHEADER: opcode = %s, id = %d, rcode = %s header flags: qdcount = %d, ancount = %d, nscount = %d, arcount = %d QUESTIONS: , type = %s, class = %s ANSWERS: NAME SERVERS: ADDITIONAL RECORDS: type = %s, class = %s, ttl = %s, dlen = %d internet address = %s internet address = %s, protocol = %d, port = %d domain name = CPU=%.*s OS=%.*s origin = mail addr = serial = %ld refresh = %s retry = %s expire = %s min = %s preference = %ld, name = mailbox = text = requests = errors = internet address = %s, protocol = %d packet size error (%#x != %#x) %d day%s%d hour%s%d min%s%d sec%s%d.%d.%d.%dUnknown error@$@4@@<@@@|@@@@,@|@K@K@K@K@K@L@L@L@L@PX@P`@Ph@Pp@$@@@@@@@T@@D@t@d@„@¨@¼@@@$@8@\@l@@@@8@D@`@h@@Ag\AgxAgxAgxAg\Ag@Ag@Ag@Ag\AgAgAgAgAgAgAgAgAgAhAi,Ai,Ai,AhAhAhAhAhAitAitAiAiAiAiAiAitAiAAAAAB]B^B^B^B]B]B]B]B]B^TB^TB^dB^|B^|B^|B^dB^TB^dB_,B_XB_XB_XB_,B_B_B_B_,B_B_B_B_B_B_B_B_B_BoBoBoBpBpBpBoBoBoBpBqBqBqBpBpBpBpBpBB BBTBBBBBBBXBdBpB|BBBBBBBBBBBBBBBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBtBBBtB BBtBtBtBtBtB$BtBtBBtBtBtBBBBtBtBBB,BtBtBtBtBtBtBtBBBBBtB BtB,BtBtBtBtBBtBBdBtBtBB8BtBBBBLC5C5<C5\C5|C5C6C6xC6C7dC7C8C8C8C8C:PC9 C9\C9C9C9C:C=C=(C=DC=dC=pC=C=C=C=C> C> C> C>DC>XC?C>lC>C>C>C>C>CCCCC,CDCPCCdCCClCCCC,CCdChChC4CTCTCTC4ChC4CCCCCCCCCCCCCD D D D ,D 8D DD PD D \D D D D DTDlDtDDDDDDDD$D$D$DD8D8D8DD\D\DpDDDDpD\DpDDDDDEE`E|EE@EEpEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE<EEEEEPF?F>F@F=F=F?F<F>F<F=F<F>F<F=F?DF=F=F@pF>F?XF=F=F>F>PF?xF@TF=F?$F@F?F>XF?F=tF?F?F=F= F=F>F> F>@F@\F>F=F=TF>F@F@F@F<F<F@xF>F<F=F=\F=F@F@F?4F>F@4F?,F?F?F?F>F<F@$F=(F?F@F@F>lF@F@F<F@F@F?F<F?F>F>F>8F>0F>$F?<F@F@F@F@F@F@F@F@F@F@F@F@F@dF=F<F?lF=hF>`F?F?F?F@F?F?F<F<F<F>F>F>F=0F=HF>F=F?LF?F@HF@<F=<F=F=F>HF>xF?`F=|F@,F@FAFA8F@FA`F@F@F@FAF@FA@FAPFAF@FAXFAFAF@FA0FAHFAhFA FAFAFAFAFA(F@FApFAxFAFAFBHFB\FBFBPFBFAFB0FB<FBtFB FBFBFBFBFBFC$FC0FBFBFBFBFBFBhFCFCHFC<FBFB$FCFC FCTFC`FSXFSXFTFSXFSXFTFTFTHFTHFTHFTHFTHFTHFTFTFTFU FU FSFSFUdFUFVpFVFWFW\FWtFWFX0FXFY4FYFZ@FZFZFZF[ F[lFPF[FiFhFhFhFhFhFhFkFkFkFkFkFk|FkpFnhFn\FnPFnDFn8Fn,Fn FFFFFFFFFF(F(FFF0FFFxFxFFFFhFFFFF@FdF|FF0FFFF FDFtFFFFLFFFFϸFϬFϠFϔFψFԠFԔFԈF|FpFdFXG3xG3lG3`G3TG3HG3<G30GRGRGRGRGRGR|GRpGZ8GZ,GZ GZGZGYGYGbGbGaGaGaGaGaGp GpGpGoGoGoGoG~G~G~G~G~G~|G~pG@G4G(GGGGGGGGGxGlG`GpGdGXGLG@G4G(GHG<G0G$GG GGGG̈́G̈́GGΌGΌGPGPGtGϐGG8G\GtGGGG4GLGєGGxGҨGGGGDGhGӰGGGՀGGGGGxGlG`GGGxGlG`GTGHH;$H;dH;H;H;H<HH@H|HHHHHHH8Hpatan2hypotF kVTM@s/!* K r#4$F\(s14mV(LsqrtI:I:I:I:IHIUIUIHIUIUIUIUIUIUIH8IGIUIHIH(IUIHIHIHIHIHIHIHIHIHIHIUIUIUIUIUIUIUIUIUIUIUIMIUITIUIUIUIUIIDIUIUIUIUIUIUIUIUIUIUIUILIUIUIUIUIUIUIUIUIUIUIU,IIIMIQXITII@IIIUIUII4IUIIPIKILIUIUIUTIUIKlIUIUILIt8It0It0It0ItTIt8ItTItTItTItTItTIt@ItHItTItTItTItTIt8ItTItTItLIIItIhIIInfinityNaNMnᯡ:MzD=E\"X$#"wJ1N<*4 ?񈙱&e}C5t}_Ͼ/@P$ k(C@ԥ* _1ɿ.v@ k:#bxz&nx2 Wh?@YQaȥo :ˏ'fKP*, ͒P(ij.QkuP4,x䲻dQ8ScE 0D<< 0 PD03<00<0U@D@ 00DA@@F]t.E !$'+.158;?BEILOSVYp*AII0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I8II0IDI0I0I0IǼII0I0I0I\I0I0I0I0IDIdIɔIɴI0IIʌIII0I0I0I0I0I0II|II$IdI0I0I|I0II0I0I<I|I0IȌI0I I0IɄI0I0IIlIʬIHI0II@$@9ffffff?֓>>??@`@V@v@@f@p@P@Lcf?FR9@ !TD-AH=c)\@s @x@Zjլ@@Q`=ag+Z> ٿ*tcE?aUUUUU Y.>!;`܌~O>qVlA?UUUUU>? m`M?f;<e&@PO3?AA @@-id-tmp-scan-prop0x%lx"%s: %s %s: %s %s: %s .%s: %s -help""for """"" :%d%g"afterbinddestroyfocusgraboptionpackplacetktkwaitupdatewinfowmbuttoncanvasentryframelabellistboxmenumessagescaletextactivenormalDISPLAY"".3.23.2"send"centernneesesswwnwcenterbevelmiterroundbevelmiterroundbuttroundbuttroundleftrightcenterfillleftrightcenterfill""addclear clear"get"""HOMEvrooty%dwidthwidth%dx%dy%d "allcolorcolorwindowatom%d"cellscells%d classclassdepthdepth%dexistsexists01fpixels%gheightheight%didid0x%xinterps10nameparentpixels%d%d%drgbrootxrootx%drootyrooty%dscreenscreen%d.%d%d%d%d%dunknown%dvisualvisualunknown%d%dvrootxvrootx%dvrootynonedefaultnonenonenone none"-globalcurrentreleaseset-globalstatusnonegloballocalafterappendbeforeinfotopbottomleftright { frame %d padx %d pady expand fill fillx filly} unpacktopbottomleftrightexpandfillfillxfillypadxpadyframeforgetinfo-x %d -y %d -in slaves-anchorignoreinsideoutside-height-in-relx-rely-width-x-ycleargethandleownINCRTARGETSTEXT%#x%#x %s"tracingonoffaspectclientcommandpassiveactiveactivepassivegridgroupiconify%d %dmaxsize%d %dminsize%d %d10userprogramuserprogramuserprogramuserprogramtitleLabelButton#eed5b7BlackBlackWhite-anchoranchorAnchorcenter#ffe4c4White-bd-bg-bitmapbitmapBitmap2commandCommand-cursorcursorCursor#b0b0b0-fg-fontfontFontBlack-heightheightHeight0Value0onValueValue1-padxpadXPad1-padypadYPad1-reliefreliefReliefraised-reliefreliefReliefflat#b03060Black-statestateStatenormal-texttextText -valuevalueValue-widthwidthWidth0flashinvokeselecttogglegray500moveraisescalescanmarkdragtoselect#ffe4c4"adjustWhite-bdclear-bgfromitem2%dto1confineConfine1type-cursorcursorCursorxview-heightheightHeightyview7cBlack00OffTime300OnTime6002-reliefreliefReliefflat"10#b2dfeeBlack10allcurrentBlackWhite-width%dwidthWidth10caboveall allbelowclosest"withtagCanvasaddtagbboxbinditem "canvasx%gcanvasy%gcoordscreate"%ddcharsdeletedtagfind findfocus%dgettagsicursorindex"%dinsertlowertag "end"insert#ffe4c4White-bd-bg2-cursorcursorCursorxterm1-fg-fontfontFontBlackBlack00OffTime300OnTime6002-reliefreliefReliefflat#b2dfeeBlack10BlackWhite-statestateStatenormal-widthwidthWidth20Entrydeleteget get"icursorindex%dinsertscanmarkdragtoselectclearadjustfromtoview0#ffe4c4White-bd-bg0-cursorcursorCursor-heightheightHeight0-reliefreliefReliefflat-widthwidthWidth0Frame-class-screen%dx%d0#ffe4c4White-bd-bg2-cursorcursorCursor1-fg-fontfontFontBlack20x10-reliefreliefReliefflat#b2dfeeBlack1BlackWhitesetGridSetGrid0Listbox%ddeletegetinsertnearest%dscanmarkdragtoselectclearadjustfromtosize%dxviewyview%dx%d"end"activelastnone" unpost%d %d post -bitmap-font-label-menu0-statenormal1-value-1#eed5b7Black1BlackWhite#ffe4c4White-bd-bg2-cursorcursorCursorarrow#b0b0b0-fg-fontfontFontBlackCommand#b03060BlackMenuaddcascadecommanddeletedisableenableindexnone%dinvokepostunpost0%dgray50#eed5b7BlackBlackWhite-anchoranchorAnchorcenter#ffe4c4White-bd-bg-bitmapbitmapBitmap2-cursorcursorCursor#b0b0b0-fg-fontfontFontBlack-heightheightHeight0-menumenuMenu-padxpadXPad2-padypadYPad2-reliefreliefReliefflat-statestateStatenormal-texttextText -1-widthwidthWidth0gray500-anchoranchorAnchorcenter-aspectaspectAspect150#ffe4c4White-bd-bg2-cursorcursorCursor-fg-fontfontFontBlackjustifyJustify-padxpadXPad-1-padypadYPad-1-reliefreliefReliefflat-texttextText -widthwidthWidth0Message#ffaeb9White#eed5b7White-bd-bg2commandCommand-cursorcursorCursor-fg-fontfontFontBlackBlack-fromfromFrom0-labellabelLabel-lengthlengthLength100-orientorientOrient-reliefreliefReliefflat1#cdb79eWhite30-statestateStatenormal0-totoTo100-widthwidthWidth15Scaleget get"%dset%d%d%d%d %d#ffaeb9Black#cdb79eWhite-bd-bg2commandCommand-cursorcursorCursor-fg#ffe4c4White-orientorientOrient-reliefreliefReliefflat300100-widthwidthWidth15get get"set %d0#ffe4c4White-bd-bgnames0-cursorcursorsetCursorxtermunset1-fg-fontfontFontBlack-heightheightHeight24dragtomarkBlack00OffTime300OnTime6002-padxpadXPad1-padypadYPad1-reliefreliefReliefflat#b2dfeeBlack10BlackWhitesetGridSetGrid0-statestateStatenormal-widthwidthWidth80-wrapwrapWrapcharcharnonenormalwordselcurrentinsertTextcompare10debugonoffdeletegetindexinsertmarkscantagyviewkana_RIimplieskana_RUsectionkana_REradicalkana_ROkana_WAkana_NnotsignunionhyphenTriple-Double-macronAny-degree%.100s%duparrowacutemublankcedillahtffcrlfnlonehalfvtTabAgraveAacuteClearReturnAtildePauseEscapeAringDeleteAEKanjiEgraveHomelefttEacuteLeftrighttUpbottRight"toptIgraveDownvertbarIacutePrioremspaceNextenspaceEndEthBeginNtildeSelectOgravePrint"OacuteExecuteInsertOtildeUndoemdashRedoendashMenuFindUgraveCancelUacuteHelpBreakYacute??ThornssharpagraveKP_TabaacuteKP_F1careofatildeKP_F2figdashKP_F3aringKP_F4aeAboveBelowmarkeregraveKP_AddTopIfeacuteigraveiacuteKP_0KP_1KP_2ethKP_3ntildeKP_4ograveKP_5oacuteKP_6KP_7otildeKP_8KP_9??F1oslashF2%dminutesugraveF3secondsuacuteF4F5F6yacuteF7thornF8F9tkerrorAogonekF10breveF11LstrokeL1LcaronF12%s SacuteL2ScaronF13L3TcaronF14ZacuteL4ZcaronF15L5aogonekF16ogonekL6lstrokeF17clublcaronL7diamondsacuteF18heartcaronL8scaronF19daggerL9tcaronF20zacuteL10F21zcaronR1F22RacuteR2AbreveF23CacuteR3CcaronF24EogonekR4caretEcaronF25DcaronR5NacuteF26cursorNcaronR6F27RcaronR7UringF28upcaretR8overbarF29racuteR9upshoeabreveF30cacuteR10ccaronF31joteogonekR11quadecaronF32uptackdcaronR12circlenacuteR13upstilencaronF33F34R14rcaronF35uringR15Shift_LShift_RHstrokeGbreveMeta_LhstrokeMeta_RAlt_LAlt_RgbreveSuper_LSuper_RHyper_LHyper_RspaceexclamUbrevedollarpercentubrevekappaplusItildecommaminusEmacronperiodslashTslash01Controlitilde2Shift3Lockemacron4B1gacute5Button1tslash6B2ENG7Button2eng8B3Amacron9Button3IogonekcolonB4Button4ImacronlessB5equalButton5OmacrongreaterMod1M1UogonekatMetaUtildeAMUmacronBMod2amacronCM2iogonekDAltEMod3imacronFM3GMod4omacronHM4IMod5uogonekJM5utildeKDoubleumacronLTripleMAnyNOPMotionQButtonRkana_WOSkana_aTkana_iUEnterkana_uVLeavekana_eWExposekana_oXFocusInkana_yaYkana_yuZKeymapkana_yoKeykana_tukana_Akana_Ikana_Ukana_Eakana_ObDestroykana_KAcGravitykana_KIdMapkana_KUekana_KEfUnmapkana_KOgkana_SAhikana_SUjkana_SEkkana_SOlkana_TAmkana_TInkana_TUokana_TEpkana_TOqkana_NArkana_NIskana_NUtkana_NEukana_NOvkana_HAwkana_HIxkana_HUykana_HEzkana_HO%s; %skana_MAbarkana_MIkana_MUkana_MEkana_MOkana_YAcentnablakana_YUkana_YOkana_RAyen%x %.*ssend" _commComm%x"""_tk%dgray50gray25gray50flatraisedsunkenflatsunkenraised"""{} {01%d%g%d%gmfont "arrowboatcircleclockcrossdotdotboxfleurgobblergumbyhand1hand2hearticonmanmousepencilpirateplusshuttlesizingspiderstartargettcrosstop_teetrekwatchxterm"""cursor""""""""-extent90-fillblack-start0-style-tags-width1arcarcchordfill stroke stroke fill fill fill -anchorcenter-bitmapblack-tagsbitmap%g %gfill -arrownone8 10 3butt-fillblackround-smooth012-tags-width1linenonefirstlastboth%gstroke fill -fillblack-tags-width1ovalfill stroke -fillblack-smooth012-tagspolygon%geofill -anchorcenter-fillblack-fontleft-tags-text-width0text%g %gend"insert 00-0.50-10-10.5-11-0.510100.5-0.50.500.51\%o-anchorcenter-height0-tags-width0-windowwindow%g %g-file-height-pagex-pagey-rotate-width-x-ygraycolorw": %%For: Unknown r": save gsave ": ""%g/mediumboldBoldTimesRomanItalicOblique-%s%s%g/<%02x %02x>%d %d true false"0-font-reliefflat0addadd tag binddeletelowernamesraiserangesremoveremovetag "endendfirstlast""%d.%dcharslineslineendwordend>D endappendarraybreakcasecatchconcaterrorevalexprforforeachformatglobalifincrinfojoinlappendlindexlinsertlistllengthlrangelsearchlsortprocregexpregsubrenamereturnscansetsplitstringtraceunsetuplevelupvarwhilecdcloseeofexecexitfileflushgetsglobopenputspwdreadseeksourcetelltime...unknown"unknown ...NONEreadreadreadreadreadreadsetsetsetunsetunsetunsetunsetunset"anymore01namessize%ds-1-%ds--"""can't "()": %s%s%s/.": %s%s%s2pHOME"user "/ "s " """yesnotruefalseonoff"": ": ": ": ": ": UNIXinouterr"file "$"indefault%d"%d%dthenelseifelse%dargs"body%d10default""10exists01globalslevel0%d"librarylocalsprocsscript6.7vars list"%dend" %d list"""args" to ""-nocase0-1 -1%d %d"1-nocase-all"01%d"%d%g%g%d compare1-10first%dindexlastlength%dmatch10rangeend"tolowertouppertrim vdeletevinfo{} {": startcurrentend%d~": %d": %d ": 1 0dirnamedirname name"./tailtail01existsexistsatimeatime%ldisfileisfilelstat": mtimemtime%ldownedowned": sizesize%ldstat": typetype010%ddev%dino%dmode%dnlink%duid%dgid%ldsize%ldatime%ldmtime%ldctimetypefilefifolinksocketunknown"": "": %dr"": rwwfile%d"stdout"": "envenvenvenvenvenvE2BIGEACCESEADVEAGAINEBADEEBADFEBADFDEBADMSGEBADREBADRQCEBADSLTEBFONTEBUSYECHILDECHRNGECOMMEDEADLKEDOMEDQUOTEEXISTEFAULTEFBIGEIDRMEINTREINVALEIOEISCONNEISDIREL2HLTEL3HLTEL3RSTELIBACCELIBBADELIBMAXELIBSCNELNRNGELOOPEMFILEEMLINKENFILEENOANOENOBUFSENOCSIENODATAENODEVENOENTENOEXECENOLCKENOLINKENOMEMENOMSGENONETENOPKGENOSPCENOSRENOSTRENOSYSENOTBLKENOTDIRENOTTYENXIOEPERMEPIPEEPROTOERANGEEREMCHGEREMOTEEROFSESPIPEESRCHESRMNTESTALEETIMEETXTBSYEUNATCHEXDEVEXFULLSIGABRTSIGALRMSIGBUSSIGCHLDSIGCONTSIGEMTSIGFPESIGHUPSIGILLSIGINTSIGIOSIGKILLSIGPIPESIGPOLLSIGPROFSIGPWRSIGQUITSIGSEGVSIGSTOPSIGSYSSIGTERMSIGTRAPSIGTSTPSIGTTINSIGTTOUSIGURGSIGUSR1SIGUSR2SIGXCPUSIGXFSZSIGABRThangupstopVALUE()ENDUNKNOWN567*/%+-<<>><><=>===!=&^|&&||?:-!~"""%ld%g"%ld%gXErrorX Error%d%s.%d (%s) %s.%dValue ValueAtomID DISPLAY%dXlibXlib Lrwidthheighthotx_hoty_hotbits[]lLL%s%dshmunix:::%s%dBadAtomBadFontBadGCBadNameH%d%d%s.%srformatformatdepthformatUSTRACE : uspsemausvsemaUNKPHIT PSLEEPPWOKE VHIT VWAKE PINTR PMISS *.: =%s: \n\ \n\\\%03owStringHOMEXjiso8859asciirr/bin/shPATHsh/./..///Error 0 : dnsbindlocalfilenisypNaNNaN-+ 0x0XNaN-+ NaN-+ (null)kkGMT TZError 0rr# rdomaindomaindomainsearchsearchsearchrconnectsendsendtoselectJanFebMarAprMayJunJulAugSepOctNovDecJanuaryMarchAprilMayJuneJulyAugustOctoberSunMonTueWedThuFriSatSundayMondayTuesdayFridayAMPMCFTIME%H:%MQUERYIQUERYCQUERYMCQUERYU45678UPDATEAUPDATEDUPDATEMZONEREFNOERRORFORMERRNOTIMPREFUSED67891011121314 qr aa tc rd ra pr "" %s %ld %d ??? ANSCNAMESOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAXFRMAILBMAILAANYUINFOUIDGID%dINHSANY%d0 secsssss: p  wݰ `x >(hq|B\T;2nژW0 0@@@ p0`P" "0 0H ($ ```2(!#(PX6 `p` #&%(8'"#(PAh&(&$(#7("! (@7 #Gh6 21& q&# !3g8!0C40C70C#hH!0 60p6!S4#E 464 D %@HV (#1#$(%# $%5%R$!X'CPP`8 #!C 4 2A10 16$0@%#"382!7 B(   (( P# w5  ""%$#' ! Q13!w%b!$ @h!76"" # %u$!rT!(!H@AЃ   P" &#@!#11!#'% &&1@B3a!`"#@AD%$" 3#0210`"C00B""""""3$!#P0 %!#P0 %!#p0 8!#@@$!#00B"""""""""""""""3"#PP2$#PPB$#PP2$#PPB$#PP2#PP2#3! "00@" #3#E6%$'8 07#1q(0s !H4r#a"!s1"3 "02#  !%!PP 4#1# 3X !  DR& $" $&   @W(!! 2@@X#3! 110!&"("("$# !34`w!"`$$Ad0  0p` H4!#1#1!1@ 3A7 1! 7  1"%2!"%2$  0!! 1@22!6 #38! 8 " E2sP # # 1  3E!1e03@  ###2 22"2"3CSCH8W#0A2%88g0A2%88g0A!%888g#00DHDE(@PC0f0EE(G H G H X6($  p  !' #3 08CH 2  #H H 21 !8"&8"!#8"&8"#PPw" 3'! #!41&" A'$!#!37!!0&7PPP8 #@Q2&(((C (H4P 00#! 1 #%% #wp !%% #h $Q"6%&"&#%2 3QR3@0220%0 sH " 0 E"" !00  00@@    a 0q !2 PS8 ! C$" X8%#!4#$%PP8'"  '#@A"#!PPR&%! (2@3&"&"F0$$@E0 $ 'PPP!"``" ((!"t0e "(!$(81($PPw"2(8!75!6!$5!4!Q(1 3!@@`'07 # "&'7A&%#% (8#$(1&8$ ( 5 81&#&8(&$(  81 5H&"(1&#&#1&#$!8888'86(8HHHH h'0 "!!"7(&# "!8 #!2%"'$ctH$01#" "0H& #!#1`` 0 p0##5#pp ""3!$(3!$&"  #&#!&#!!&"!8$!$(1&3   W$0s'$"42 (C 0082"C!8$ !1""`s2 ! 1&$!& @ !!!$235& ! "! 0' 1!2  !8"!! 18$PPX8'@H#(#(0 A8D@ '`v#$48# # #a(%%c#(1a(#(F2 "0#0 0  P0$ 801!p P"8 0!3Tc( ##B3p@H"0@$ B 4 2 2 0 $0B0PPw"!(D!!(((T!!!(T!!(  1#1(s($!!X#$##C($!!"!(&0 #p! %&364#"  0 511% 10 "11% 20 ! 1($ 0 @ 0 4 @ @P 46  ! H$#2 30 #(0@3(! #(0@3(!PP`%`p 458 !@4H"11`fQ !15 ' ' ' '%F8X H0(57@X%"c " "##s$ !20A3"#1$ #0!"H&(43#0 (0( $3"# 4($au!!!(H"(%! %3(% ##88$((% $!8$QT! 0A!c4#@Q3"!#1 QT0'#P``` "&2% H!' ( ( G85 3 (C  482 ( @0( @0( 1 ( 1 5 3 (& 2& 2X2 $ (ppu @  0H1" %"" #@00 4 @3T  ! !Bh $0 ' #3(#V04 #@C 3!#  !#S"$!$ C1@30$!#3@300!1 8SE"!H!#25B!!"0 (0 @@ !r2#1(PP" !(%!!Q6" #3"$"c(&!"!"!$## $'!Q("!&!""$!F@2!@#%`rX 0 rh1HB X3$85E %$$025D%" B`b@## u &u @ B#D$  #0"!!! ` ` """   @@Ёx(!# P !!Q B#%"2#"C` 0P0#07 XE $ 00@@Ht&1&#1! 0H3$3 85E0S5E$"B$6(0!30H ! "" #0XHSU!" "'r 5% (0#4  8#0007#"#3Q##!# C$!!"C !!"H  5(p`s4` $$  T  %1#3#0!$#$#C0#0 $$""2#1$$@!##$!C3 #pp "0!(&!%25!$&038!8!%X8 @0286!!% 61#$5#mC6!!% &1%# %(&01!!6!""  7!D7!$# (8% 4(38!8!%`0Сa 3## h""""2"836!!% "!" "!36!$!%"%0!&#%06!"36!$!%"%0!&!"136!$!%8 136!!% "!" "!#&!$!%8 28#&!$!%8 28C6! !!%&#6! !% 728S6!CH$S## #"#$!0$(6! !% (728&!("EA3&!!% "!"$$(&06!"T' x 0  E#88H00"#8'$$1$!%#'#  4"3&rt $$8"(0"#((#`% 01#$$$#@$# A $$$ 1! 8!"8#  888H 00 #4$ % 5 &&&%"B0@  w0'D!@#$#$1(A$D"#( ߂!$"#$"#''0# !#3&"43 `p P 0! "05  5 " 5   @ U!F ! @ !8"!   @V0 RH1 (63 4!0  1 8$"` ru#@!W @  1# 3!!##H`@#%#!#x#``0@@@Cx!u  P &'(2``t%0!(4$!((88Z4$!84"$!14$(8!4$ 84$4$!8h!101#5##############5####! 6#5H (&T @! " 42%!12@!#44 #@!&#&  $ XE 54%E1h4 ! H  0 (`a544F8#3F3 8(6H685H73 8001(00 D(81@!'  0((8H8 "# " ##``##82!%#8 ($! 8$$$%$$ 7! !X$ (04!4!#%8$PPc4(7! 0ЀP@vE''@Bg!78j"@w1% $$$$4!37 B## 3&B!@3$2&r$8"C0"(C7&11!C7&11!'(6 87 !&%$!&1PW"(F #B  0 &3706(H1(2 '&35%&#@3#! ##7#C7!#%"78(7 !&&% 53@&(' !4!176(H5(&#1753&84176(H '&377788(&&337 &2178E&(&370$'317X(5&(&1'8H ( (( (1(( '81'"%(361(B&7#( 3'#6087 '#(7#7(' ! (1'%X1'%H@A !######"####!QW !03   e#6 208q46p@ $$$$'H  XXHch 1!'10q14 #qq'#4$$0  ##" Sp  ( ##40F`s3"  %#pq#"  C1s0#$ pp " ' 85!(3#( "(c8H"$&A` !7 @@@ !8G#  H((8'(58($'%q @ 8H# #a###! C"q1 "#'0Ѕ 80@@@@@4 4!21 %" "@ ( XP!8H# 1P 8pq2 B$pp !  8 #0615!7#6#E 3#6#@@P 8@!$ 0H&#00A%838 (##( 4(&&$"3$(&&$"#  0#G00E #  32#PPw5! 0Ѐ`!''@B``g$&'7G37(2 &1(&"(7521'&417(5!1''H ('81'%('#1"H7$ 27!7#'(1'&8!"82#5#######"#! 60 ( 54E &C @@03  %8$ ! !pQ   ( %H%H! Hxx1H818H H AE  $$$$3#!20@!E ppp 4 !!$ 4 4 C#!011"1 ##4 !7 &"B28B83 X 83 4!##pps(Xp !""001E0!@@C$!&05 3 #@A #&6$#061$!'!E 3! (14!  '$  0 (7qq! t!2p@$ '!"``% '(6 G$01##!!'35'$"H$@!PD78#23( " ## 2PPw5! 0!''@B`Ph"!(&(87A8$(38(1'DA('3#6 (18"5(1(&31(8H  0((81($((%" B((8 "#(81(&71('3H@A ###########!`` @@03  px$ &  ("! &  ``!  38'$RP !8`X 3!! 8 $! (!'! "'q$ # $3 ( $(  44$ 2&$10x #&!#(6#054!# !#  !  # % !3! !P`$3(1p$s$0 51 # #bc"42 b0#&37# (3@A1"7%#@A3428 '%#S '%#`` ! b`0!'@Bpph!2(3('43(3b4(t2( ( ( ( ( H$6 @ 8'(7 84('4 '10 % $!3('37"3('35!48'348(8!3('3$!3('343&&$'!C(8"(#0#(("# (3('3(!H@2##############! #6%%3############!qpv $#@!2%!12@" "@  0 ($ 7  5X "# "4!&S8   #0 3$803 # 0 225# $ XE4 %pA03! C"H#!#(3"  # (! pq!83Q"dX!X(! 5CH3HX Hs02251 46!b@ ' @ 488HbA(X&H104GGC4"(!3!& !346&86"# ##Pp 7" !"184@@Q1% !E%! %@@3t0#! 4$%PPwu!s`p@ !'0``g% &$!('(7&$!Wx Q !##5############! 6H &T @" "@"2%!12@!#54%Eqh4 ! H  0 (`a5!3E8!3EH#H584H6H8 H8 "# " ##PQ#02!%#D% (04!4!#%8$PPw5!3 0!'@BPPw" ((8G01#5#####!6H 54%E "@00"@0833 (4   1 %C!X# !@G$8!5! !`Ap4!750 !1 X!7538u 1@#8(23 " ## (04!4!## ($PPw5! P! 5'@B``g% '(7$%#1&%4&$"!'q01########!ag  7H&  # 3 3 B0 " 0 # # x (( ` #3 6&X  8dc$2C"H#Xh$" 07(! 1`G!(hHu82`P 'uH  dc$2C"H#hX$" 7(C!`H!(hHu82`b &qt800X 81b6"%8H"10`808 523 #3#10s&( &(!SP`2#0#$# (4!PPw5!  0!5'@B``h# '(8<'H1H(3(3(831 @!(q01#####!QW  73 3#$  C H 0# #` (00P (pa0# #% @8%!@0 (pa0# 8AHH 323!##2P"8(8#% (# $  !  8##00B@ U$$$"006$$32"0B" 88!6! !F#"0"%!#$$!$$!33"6!@@C3%#4#40H#553#5!PPxsu!3P030Pc"6E''" #ppw$0!(A'X  0   0 G2 ( G(&'6 8'2% X'8 2  8(3'8 2  " (B01$0 (78 578 5(1G04!(48( E!$HBc%%###!###!@PX $h$C wH$ #$`PPX&1A@v($ D 3$#truq$ # 0#X HG51A (q``q  8&!2 c 4@ "3@s2@01 (pp "&4(&($6% ##"7(S 2!0#  #$&1 As%@F1 " !#$@@g'$" "8$ q"""r " $"rQR!'E##%%`b!"  1#1"0 1#1#S!% 5   2(1&"3C !&0C#%331#"#cF 0A#1"   #@4#pr #4#4AF!! !!#!#%  0@! 1' 4@30 0 2(  #%   C $3' pqr5&# $' #8  d 0 2 @ @ P !X3#620 `  " #0(@  H( 80!%&#ph0 14 CA44 W4 P! 0 CcT!T!T03@0 a30$@  `    "!"( 000000020@@00`"! "( 000R!" 0$" 00'B! "!"!"15T0@  53#!00  V0 & & P S2T0$140 t #0" 2#` 2 1 2 D""B2!  '('$7Hq  !B'"# 4"$!c6#  w0#4%'$ #q2#1$ X"#  6 !!#%s!# X"7   $ 0 4 02X2 X!     !   0@3!$2r "65%     p 02 0"A@E!(@Rr%123 0!@B#1"X"P4E0#$@5w !# # $''$pp  4(6h B65&$(' % '0@#``q0"    8' 56#010`$ST8 q 28H%"#0 05P "#310## 8r"!E01r@A2#!p'1b 3! "c# 1"a% %p020# ! ' 32d 343x @!  `H&57 P8q@p @#00%"2PPa6'"PPrP @PPrP !0PPbP" % $# `  71 8( !  #s D    @B!T@d8P 'B00!1PPPT2H !(  P5P3400#######"#4@Q"7$#-((t 6 26$!8    H(#F(#H&!&0 !0 " "( #(  !!!""!!(" ##!0v!r&(D  8G@!'PW0''`gC8`q GF6 1& !& !6X1(``PA%EEa $  A &0a &!00a &!00a &!00a &!00Fq &!0 !6FFFVVa #!@hS@@4 %!$! F33#0 @`p (# C4000P P P P R@ R22234P x1####$5pp   !&#!e' PPv%@@@R5""##!# #(38(  ! 318 (a##3$703 03H2$03x8 0#"3!503 "12@ 18 X1$1q( '%(C4 r!"!" "!" " "!" " " "!" " " " " " "!" " " " "!@0    0(86  0  (" %5PPbP" ""##  !0   "6(1H128'"8'B"18 X((("('5X'("H'8'82b@00%0'"2#$   Р   &&&1("(#' 00  "2``@"!07PPbP" ""## 00xs0p8%@x"4% !@87C #  #$ #  $#@&  !00%# "01######ss1(11   1 !(((        "`a(#(  00 G30& " %!&'14D`a 8% 088t(8(!7! $3&(#!1 ((!(@HD!&t!! @0(0Q !3!(C!(!3!( (#! (8H3(H(  (40A#1!!0# ! (' $ ' ' & (!&@  (!ph('!ph('3(SQ !38(8(#(8a8%#%3!%#$$5U00xq8%0H8"4$bg$# "%01####A0@A!"0@@ 0 02P 00Ј #@ 0a`p "6  "6hX&40A#1#   (t8(8%&@@   p (38BP  !"%$4462$&"s#$"(qpx " $5#a  80 #(72r$01######P@ Q`  h##t## 2 %176 t&&4 350  ( # (8 # #R((0(!(!# ##pr( ## #!# #g( 3500$(  @@ (8  02((0(!(! 3r@@ ' 1'w(PPH!@! 1!##@! 1!#!PPD! @  #@  !a`26"'!#X4D(@108#" ! 00!0$( `a E0# ! 0 $ '! 8PQ&&"!E   $  $#%4s%3%4%3$00x 8&@x"4%rw # $#@! " ## %01#####x1(  0       "s((3'(3  @  #!!t3  8P`1(D"hhX(  "!PP ! C A! A10@ @1`H840A#1!!0#Se 38s%#%3%%#%@@(3HBPV447 (&#x"(rw ###a 201####P@0аQ` Cp (8 301C%  46 "%3`a& 56&$`a 56$$PPH!PPD! 00A%%u#%3%00h x8%0H8"4$rw #$#  s $8E201####### 3 !!BH   5q 0  ' b( p0p  @' $(@820`5  5%"   Pp $q@H  H  x  $'   H!H#H"Q!!$3 $84"P`$"Hs! 4!$8! D! 2!   3  1"#(0H! 40A#1#E !8 '"C28Bf08"$1((3 40P !AP !'P@@Pa5%(#$("HPP (!"#100x 8%0X8"4$@@a`hs## !4G"1E$B$01$$#10!0#@00 4 @3T PP  %#@ 0a`p"6 "6hX&40A(#!1#3!3# `P݀pڀ0P P1#!%0%0%0 "%0 "( R8BV "   HBBH85C  8('pppqpvpxaa`a```h6&($8#t&%"8%8! %%(  % 853%T$# r#!PPa H$ (d7$8#4$( 3@  2#$8 T00('! E#C&(4(pp4(@ 0C40$S58 "@@8@E6(AAPH0Q`!p#2C  0! !5 4 0 $ #$  !8 1q% C & " "#  03!#!' #40p0q"1(  !  !#"   S$#   A#$ $ !R##$ "## 34!34!# ("E2@ 210  @3&G$4 "!534!` &! c! 3  3! !0#! @ !!C 0H8#PQ '003! #0 63 %633!!` $$'app s  !2' B'!$A" !%4!  C!$ "C!4 "r "!   #1!" 42  !! 42 ! !! $X"% 4h B " pss#2Aq"!a!C x7(2sc##qp""h#("sc# (QR2d$$ 2  8"P$$%#$3$5 !4$2#!#!32!%!#"%"80%##!5###!#$"%$B 0#  ! %@5 0((#$# pp8((8#" `cq Pa " t1# " 0'! 0t '  0d 20"0EX E@P&%$ 2QR 2sC%02t1 $ (00  %4 5 ts #!q8"!($8@U C$1 " (@@ ( $#&885 6$0 $hh5 884 X PP    6afHX X@h @ !61 7! (#7 (#(vH4 ($8#sF dP 2 3 (8c ga`005! 2 "71(  4'#56@Q"` # !#  $ 3 !1( %6``""48"#(@8(($ (7"pq"@3&"&c$8#D 3(8#8(X 8(37&% 8(8!tE7#!#% @0"(PS7#S(8#!#! E7#!(# (%H"E7#!#% @2"(C'#!80h&T"0 4"!%$###!PP (( %#0`p$%! $#@ 80@@@@@D 4"0 !A % "@ (R5 (1A08!3#8#@A  """ 06V0'  60S30(T`  X @ @(8#%  ' 4%!v@p&  & $ P  0!    (&( " %!01$@S 10 070@ 3 1 ' '' !(( (h00 AAA!0!$ s((p 0070  # 03   !(" x#x  !q"(x(s!#(v(80!0Ј a((p(08(@Ѐ0030  # 03 7( #r( !%%# ((  $( G( 8 T0S1pppr@1pu81$!$!H 000(!10((H 000#(!!0(' ! " 0 "C(v' (  1@ !  &   !PX1!8xR`X & (( WA!%"4   0 P!88040   P!8807 $$0( F  $@@A # #0% &#%1$" #%" & ! #000 5 D08"w$  p (!B ` P P 0 P (  "0b 0 2(T! 7  (82 ( !5 4#0 %!3$300# q 0 @p0 ' !$ 3 "1  "4 ! %' t0"!1 # $(08A0  "C 3$0(7$R(a@ ""p4#! " apS0#18  !3#! #33"#111! !cP!"S! !&& ̀ 0 0@@ !" (@"!3  #&0 8"!"0  3& 3!aE0( %Hs"""#4d (#(4%%""(A#PQ!#!!# (q FR1U # 1$!(P 0     !03"#1 % c53@ 0'    b%4% 0!U`e 1"R`ba 1"a%$pq%D`e##BA`Be##a0pp$t$`e1$2ps`e0$#a(0apq$`p! ! 0dc%#c( 0"$72h#"$""""$H &"$ 0"$8 0 h(# $$" ( !"( C#8#xH " 0"$72(#"$  "%""$ " ( ($("" 0"($H "# &&83#s#0"$8B#$#($3!8#%&" 0"($H2x#$#($r(#!#7"8"8&4(&( 4(6(( 4(6((P$(u#8$&v3((U8!3((&&"C(88C8(T!$!S( (#3(#8(#(8" D(#8($830dHw%4 X(##a(" (! 8$(#"P%`"83t%"83 $C% 7(((&&'3R(($"%$( "! !  !3#'! Q( (8(%%#! (#!($# $#" 5% &'!#Q" S #'!#8p2 ps#(0F&%   00h207!!$!"@7"(D& @B&  30$        0F$`` C8%("($(  "" @f#d 0 B s` #""  u #@C @0(#!(q &"!#" 03@F0!  2B"ހ`0 @00 `  #! 0 !52&("  H"8(8uH38 TH#S8  CX$C8 B2 (!%!(!X8 %!@"3s#" ''##$"00A!`aA !21 @!100!100t%!#a`h68   v4660p`P@@@@@@070A0 C A070A 00%0!!a !  S 0 (!!B03`0  !B!  " "0! 0 !Cu!#P3 0 !!  3  "  05P 7p !a3p1  !C!  "  %! 3"@r$2 6 Q !$$!0 80  $w(1PQ c !   ! $!" QQ!0'@@5$ 0 #0!1% ( !$P !'!0 ! !!1 1(7 0 @13 5$p@ 42$@p%@A 0($H@10  1!  !818$F`! !%" (c! 11#""!$@#!!!c "" $02 """TdD`%  #"'PP P###Qb@"0PP !03" &!@ACC%003@#!D5pPB 4 ($55 H81!f!1!f!s0 !7 !QB`rppP&" 60 !(0 (0 "!G2%#"5$pp   0p!!$R 3'' C 442B5!p3(002&(&#174 5$002%("("@@g"3#%6600W4"!02!#41%!$1!1!'@g!# D!  "5T( `PՀ B 4s@  %S  @0'0 050 # #0%050 # #!0 !2C !u@2E@3eP @RX  %U&#0%s%%  !3#(5 &#! "&#!(0 !D8PPR&6!&"# F""#!  "&"6#$&"@8&#(&42(&$ !!6"18&%E 61!"!&#D #!0A1&472( #!E#5$#$337(&"2a(1&#482&4 82&#!&A&# 482xPPp'6#$@@g%"'&"$"#$(@@g&!(1(  ve(7$ @@f'&!%5PPw%#(%65u&!%45!(``e @@g&&"#$p'"($x%"( ace5PPv&0 4@@e&%  x1%uP  #8 8( 3 B0 0#"82 (S#4&$  #$3@PPw!  tC3#rC %" !0   #! H 4( 0  (B! "p`  ( G3!4 # ! #%! 43!&@CP1&#p` @@  E2!q4 # ! $ 1 (0V 1  # @!!1!# h0SpS!%P3a A3(``%&!%&$7 $6"$  @0 601$q Q A!! P Q Q0h""Bs( (  ap!FEWhWX8PPp(s0  3(pP G"'#"!' 18S3'%(!('08'''%"!3'#86#"#10!(3'##(3'##(C2 80338 3 !( 8 h@@g"!(Q&@  SC" 0C'8a&@  S 88%(*QGH0 " " '7g 80!!   s$$!($00W@A!#415R!'00V2"""#($@@G&(s(7( %B00V&( !$ 7!""b Q716'02&!%"w"pc!(8"! !(32!(32!(2#!81&"!0808 54(0o@(5(&54 xC38!854((58&(55 44'"$3($($($($($($($($($(8$"@@g&%'"&( 4ppr%'%' 3A("@a @(!03(``'5pr 00U#!$T8w6#%36##&## 3###!00V##%!` %(' " #H%& 6$( 4ppr80 8%'0r 80` (10 "('@@B%((1T(  87(D6&00V%( G3B"5!""8PRPG7 0&38&2!'&43b Q7!8 q 33#8@@C$'PPa A!"   5ub&@Q!1&PParEBb$``C!!#3!s2'@u#%!122121b11111a111111222122aaa11221b11111 211112111111222 22111111111111112111a1212b1212121221aa 21111a221a 113!111a111111aa11111111111111122113!222b221222bb22222122222222222223p0 ( 77!% 2$P`qpp %0 2!$!"! !#$0(!#%!!P(!%P'!%1111111112  0 U2  0 U3 !!01 !!3 !!13 !!11h@!c@!6 3"#!C0!#f 00C08  a` h    H # %C00 " $ C0 # D D!X 103[ # %#03@ 3   C" 86 C8#& C& C #" C#(503#(503$(503$(603$(503$(50333 '3'B c!1& x 4S#!@  !#&$B"0#B"0#B"0#C #C#1 2 ! R# 3`a#!401' "0X"#8&X  R!2(!0(!H5Hp`P!!%2 ,1 1   p5%##%T$!#!Apb0#s"#1!(`` 1'2##PQFRpP!1R4#1##"011'! 3 !C%PQQ    "! 3 !C%'p@B3$Q -  @#at!$#0(' 4!H2 `!a313^###c"4PRH"A#A`&3C@U&A 4! (02$bb !HhR r b r'' r `4QB r b b r r b b b b b r b r b r b r r b b !("2  F%8 &8H#%1`('' $(#$ '#(#! ((88(#p@ #%%$PS%00 03x%#P0@'0P$Eh%1(#%#3% 8% h5 $ P8S(&BPP4W(xg1 PP 8 pH'$%%P8'`7PH'`7 ! % HH  `qX(#8`!    013&@@@04P##&3$'@ & !P U! a"f 04 7q! D(552 '!#SG%!p  ! р h#! %pg#!T@0h#!T "x#!T#'#!$ ppD$ @RR! @@E!sU!b` @05!$R@h #4#4#4"3"343###!H "@  "%30 "(7$X(0 P%@H`08(73`h# "@7  ! !8 "A1 (H4X!""%B""""""""""""""%8#ppX `@r""""""&8%#H "H0 EH@ EH EX "&@H !4%H"&8 "&H "&8"&H "&H "&Ph""(!805d`" !$  (#U1%2#s %#03 5RPX0((!&&(%`q$$2!" X!8@H0pqx12 #36"(`0!(B(( " 3C135"$3"$P(' # @ D"31(S3#X'3X%3%X   110&Xp`P010&H "H "@@V@  $H%H%H&H "&  8XUd`PW "!" B(0808 ! p%3 p`P@%3`a`h```088#D#1('@&!(" &'(PX1 8#'5#! !#"P04S%%P `dCXP@0 %3%H%#%PQ`"   DS@B8x #" DXP(@@D&@@xp85 @ 28A3!28@3TxP% @  h`rvPPTp P@@ 1h%@@D%8 " PX(1  1(1(((2Q$1 p8(r1(4!H UX FH&x H0`08P 045%P85##10@D#7 ! 50 !!8 !H !h%(%8PW(0#8%! "6x"#7%2#$6PQX0#8& 050( ! PXp P@0#"8PX@38%11!!!11!!! 5 1 S 0'!  `1%e( $$ WE $5( X(!BB &"5 (W 0 E` P!0 ! # 1E Q%x % 0Pc(!'#p('@F%P0d%P02@3( #%p & $2222222222"B R B222"""20""1@A0  %@H%X%X(X(8 " 0  hp"r "b 0  h`v#@@D@0 !8% 0  h`Xx @p` !%2"%#8H88! $`P b(0AЀ !  H8 $ QQ2Sf&f&`!q4 &REaQ!3 5 3 4 @2 $!3 `Ab##h#3 rP("qpX 64  @P0h! s 8% ("%! ! d b`b`0x $h 3 X#v"  3 5 "BX x b!#!@ !p0@@v!B""G048 x6c#43R87#wR@34$1##"$D(  Q!!# 3#CPr $! #S#@T( #$ % R  @D X! X("hS"P '#P`!#!!'#@!@! 3 %x6"(60X0 %A  2%##%R r b r## r !B r b b r r b b b b b r b r b r b r r b b  !("2  T% 208#0 $#!#a0 "!#0 #((!#0 #((!#@@ @@ &&! #@ &((!@0#@ &((! 0#P ps x28" 3(H8%00108` !(X  (Hh81GD@H#$#0Pa `H(h 3(D8E((((8$##08 83X' (2$58!HS2HGEX@@$7 3$  50 1((8'XCH6@3'@3%Pp01AP 0"A@ !0QP Q ###0@7c"!12 !@ (!""2"' @b(8 & 02H !08@(  5!(23"&PPT !"&!H 02H( #!08(   58%(6PPT !"&'t  @x8 $AA  2`p ! %%"%!70  (  1%p0 (P00"(A%P00"(A%PTS!" %!! @ %8#$!e86Q$!5`!P1$&8%G03%!PS$04UC03(#10##h%" 5C%b#0  70"(## &(s%1B  %H #q !# %0 (#6 50!1SF%#c6%C8 3G H%32 &###3!#80C##A33b pf p(Q68PT###'`b!"5 gA%3@PQ 7B4 05 6EG5a #30%   #" B R R2BBB B"0R a Q 0Q Q 0Q Q 02 &&B 2 5 `P 2Pt#"!##a7#7 E!" "0#4e' "#('s((!C4" $(1ppd1$$ '!X!"'($(!00EP#"! 1"T!! R $$ !$(0! 4!$(`62S"C PR  #5 #$ %6@ #8# $0 #2'3 "# vA5 #8061%%!(5#(f0 !#(##$2 D!%6""$#8#7PQ`(#&6 "$3('PR(#'6 "f#(% @07P1(  P@" !'@1(  027#S1$#%C$3%&ڀ'و'10 (F&ڀ'و'30 #3 (H04%a`b! 7!#(( $UE@ # 10$" 20#(0 #F "''5%!5 @H8 "x2!rb " #8 2`&r0C!@4 p0("0  "2#4rrq8 ( 0 @@ !p@`28AE((8#%0PX0@1$5 #0@(!00cPs3$ ""(($ !23 #!"$6t !!0 t&&!!#"B !"!A`aa  03C&Q%p8 EC""3(g#&@C 4" 5!1#@ h1! @B@ 0( 0`" &#PEQ  &HA&1!    0 !P `02(@ 05 gPca!t03 1(`s$B@B00 0   r#"D#V(%0A#& #!s# !$W40SQ T3 35A@ " ! C(!0201E@2#``P0! p "!" "!" B33 #&3602"CP@@` @RBQ0 %@A& !@A&%@P!!  A  0 ! C !1###7#"!%7X%#%8@03302@@f%#7X#%c@@f%7H#dX#Ha%33&(%a$" #@1B !$&"4 "#3###!0 2#A0 ``U$62V"$1&2P PU"& $2&2 3R@c78D0!1'$8&%    1#  S####!@1#(QPPF$$!0T T"!0T B 3!1'3$8&%P #60#1  b "  3GC( P5!#5B"E@"# 0H01!(P"50!!"1" 5#(0  0`@0@ 0 P00 Q@00 0`@@ @0 0p@@P 0 P00!  PBP0@  0@0 p" @Px0x0QH 0 0 @!`0` 0 !A!! 0@!P!P @01P ! !!!!!!!!p` 0 ! 1Q!a1" !QP 0`1A0 0A  AP@@"01 @ !0P0P 0  " @@2@ 0!10A  AP@@"01P!AP@P@P@  P!AP@P@P@p`!`0 1  0@ !0P0P 0  " @@2@ P!2`0A  AP@@"!p1@QQ@QQ@QQ@QQ@ QP`@ A@P @ @ !0P0P 0  " @@2@ P!2`A @00P P A! !`A!0 !1!p 0!!0 0 a@@!A@ pP!`P  !0   0 P@00P !A  @@0    0 b @0  `Aq!p PP  0   a0006!#" 400D00Q#"00Q#3!##5(ЀX 3"0&T1""% 0P@ !! X((h!( !`P " ""@T" 18( !P 0 %AA("0"Q'22708$010P@ !! X((&(!(pp40 0B@ (!@q"0 7#C&"#@B@r @" %@q31  #$304P`00 0#`r8!@!2 q  @ 0 p p 0   r Pr Ѐ@@q  @ 0 p p 0   r Pr !!PPr!!8(@CF@BFQ0#A P ` q  !`  !a 0pp !p  !1P!P10  p  p @ 2(01`g 431( 7F1H&"!$%'`q@34!!8HD1C18A#18!QQ!abh"00C %!("@U1@ 6  0"0021 1@A# !@ 0v&4% !HR(2 h1(@ (4##%@1H2(7 8 8RPH $##  4"2$(168ppR$ !0 B! b!2 @A #0U@@3@@@3P%5#!!SX0 4@!0 $H30H@ !!!! W3&C!R7 @`p023!H4"4%0#0A@%5#@1 !(!! 3$"b$'!(# 12@# 62154  080##!3#####3@@A((a  7 0@AR! 6  !0$!(C1&!'@D  !2 q  @ 0 p p 0   r Pr Ѐ@@q  @ 0 p p 0   r Pr 06PPX1U"(s "(2(1!02 0AC@H  # DErWeg05WXA1 B"4U"(   (PPb'AS!0RUA#(! ($(@@R(!'!!!C@"!#'f !!"%"C(28 ! 8$ P!A 7PH    HAAAAp Be@0BB  !0 PrD%e'c`pr3 @#A "Q!r u'D PPB'G@!0! !0q!V"0@ 0 (b HU!"!$!3  X4E@" 788C1HU!"!$!8  `PH35!"(0! H!1" 7 0P715 "6!` D `r 4 2C21""25( 0 "    3A@3P50 " # !2&!$!  ! `r ( #0(R $`hD($G1!4 dH0PD!S"#01"@0( 8 8Q"050 1%02 !0((2 ""48"!!@"67@   1HV #hS @Q3 %S5ap !   PA #( F((20 0%(0"@hA&(x1"&@ 18``` " QP@@@1 (1"(5(f8 &AH @0X!88#"(8'@S%( "!H5@ &X((PPX (#!80 (10@$! !!% 15111#@P#%@ !% 4!A 0Pa   A  A 2pp #(  (!00Ap`00 !! 31 6' @&%%01 3 A!C%%"( 7 Ba!!0%8qpX58Q%!  @C'"$PU6 #01 P 6! 4! A%'!2%PS!& !% % 0p85(%$0U&q0 &'0h800f5$(C!% !QPPT%8 E!%5!H%(( 00`1%QPP4" '! "(# a @`h!T08(  (%0@0PQQ!@1 0A 0! 0A 00p@0QQ @1 0A 0! 0A 00 0Q0P0 2@0@ PPB`P0P bAa p2 0 @P 0000  @`Q 00!2001  0!A  0 P  `@@  010@ P0 @0  p0Qaa0     ! 10@ 0  @  1 "!0X0p`h0010 %" &!13 !1!  A f,##0!1cA#  3!51!13 % 40#!Q 206PU !"A4$# @ 0!  E#a P ` q  !`  !a 0pp !p  !1 5#  @ W$300@P !%P" u =00 R5(AE%"(3`!""8!""   5!!"" 7"(!"" !1%  ("(!"" 3T(2#B!""e(%"!%"w& H%" ($&%"!US'%"0U1(c"2C! #!"#!!P`p 0      10p @`@ 8(8(%%%$4%(%%%!4(&%%!5E %X%%%%( A  D!&3&44(#@`1s %##%$2 C8!c2S2S2&H%UP ((' Wt3##4!8 2("344C$30(!""" "1!!!!!!!!!!!!!!!!!!!!! !!$@S1 A!!'%ch "7 %Q  4 3 (0 !    !8jlx!PEUGxZrtpv5 >L SHdTHvP?^PHRpu7l 08 @ DB P8@ p@J !tYolPImcwT00% 06!&8G@#P0Z%p09j|'߀0@K)0R^$+ 0epx-0w/301G0<3O05c7t90&;@BLL=cd `?} |A8I70ck86D`!J #Ȁ8K h%0b 0' @F *`0n ,~8*8yT.@Pf(0|4s0C68Jd9T|;0/GZ =awp8=pt%PP1\ H PN/06eEPSmkP@DрX t]PP Ll, ˀHb 4`0$ 0Jc H`| P. 8NNnJ0f@n`i( @+ 0@3"d8Z$/aXMyk0* @6H\p ?H1=j CXYxp     @3[ ,(v ( 8PU Po0FL @.Ce D0]nz n\0haT:hxP t ]D, ˀH=\ *`eE0n82Yt@&?hq"*/,M:"~0?Gs@ |c{z T P < Oi(H0 P \W@"?"<0WZ:\0t=8HOhs 8,  @ 1X4ot0Mf\W0~q0 @)D8BU#mPs1 @H< πPU 83I* `8_n9 GN>H1Om\rX>? ǀ)md Y   "*dF]"$0a}#(&ʀ0#(P%* dH:8"ct]hD`؀@  :8#1p \`La& 8.' @/Z+ ƀG.H / 00 :81;1L SpV 4 '8Lw7H Ҁ||8@ ?9("J /; $À0 F M;P&Ԁp i =(h l=*{  |~@,0p B.H B0@  6C2` M n%D4*H ?`]P`[d  8s \ l(z\0P,ˀ`a08<f $ HXL hT'< π89( :lX +4 ̀nC/, ˀ80p 01h Z01 i0#2` PE4< ;58 Np :[68 d8h !y>" L r@$,h LB&@ rCT(ՀX : Gp*܀` H,%8  1%IT.U8 J \3J0P v EKP2Ԁ8 iK48 rL60  wL|8 ' .~M\:W( I QT<U8 S>X TL@0 6 B%Xbv}SD C8k| l.  Dt P/F@G8Jt݀0Vx`@n0Yv0 58!x^0 !o0+:"!lSv#T#Հ0 #%0$x' @*`PYl04A{ 7``{D P Ȁ00P ^mya<48y l &xl pPCh@[rF@`&0o(J0~{0:Sat݀0z <8!!c`."#0FM#<%π0jq#'%$d) 5%+ mpLllo>@w {H  t(lId#* ` - v09H. @e/ 00 3p1 q@2-X3iXN>:8| l ( 0@Op&`f,HPaH!8€8:VQ tue ; lP F0@ zHQX<chX0)0g j|F~ _ ` TPԀrTX/k<OMhT40l0<!PԀXUmA0QX,gpH?r0  7 70@ i0JOlePT0jH4A0W_0y!0&P $%NX=pMH Rm 8# e@>]$Hv(Ju\׀@S?_XS 10k}!p\h ` up. h.QBhnZ,KHl[0j E` $hG 3D tu^l2A8>p pi"g\B"$`]$@& ?H t4(E< < p5Q ;p '$ `/0\W8  u08MiqP9N0hm0*<LӀhcT c8 Pŀ0EJ 0ju`0 @Hwo8, 8AP_?@&t@%?  X[L ӀH.?oP\oLHE@ <|(I`X`ct ]yz `0|0HA hU X!*[ #0>Aa /X_gHpS`+PnM+} hY gH03`` X03 y@#>07;U À@R\ TUh< 4dx`\g&8H?V i0jnL` ؀ @,A HZq 0PnX ;* lX=| 8TՀQ Hxk% H<NmB#,ˀ@`h#0$d T@L* l, - @&/" €(u5PE8 |& 87F; HbGX VPx08()@HNL8io)0HP" ?@C0  trĀ8-F <, $  _0 @0"0ǀ. !PLT! C|pt&"  [)x$ ^8}PDQXt0d- 8|R 1` `y x'p 8  Eth(TՀ@GOs0jr#d@b#)t@lK G8j m@v  A ,ˀL ]{ T  C0 n0!@8%H1HF8)tF- 8] @Xo k( `CpiHvP(9Z0L@v|i8t],6Pk8XhYH!?pi#,lPE8 XE) 0^hK S q8080M(l{8@ |8 H d0x6$ 0UzOp\p-wd dKy\ t 8 NTU?(PX@+8 0-@f81 v:9 dX  rU > l[ r87TՀ@Pt, 0 C8J8bx\P @Ve"&@r4$̀@*Xl&HE}(h*;",`W#`. ( (0 3 > @r $8 2 GtKz 8M,ˀHY@t H" <>*?H%LX@{@@ 9"8$?a"&@{@"(`VheH''87BJ C0ZhR r0_< ~TՀpPXLslT6P,Dt]0iH4Thw v@ @# @ЀHE-: E. `H T UpF fG$8p0=M?Xx tH`Z$ ?0*( :08pho'P-?zTUgt݀P b4 t7 $I`b815@y`0XRnH@0F`PR(@.=f ŀ?H]w",`gx5=8PVm} :@h ZdL 8R]0v(ʀ8P ,K@(1`t)8$PT@90VD [ ?t0P7ff.~80|_H1A$ɀ8`, 9H x0.06 0MO; ?Xi@@Ut GP8 NH.Jp pU` .@5 uT€H"XP>8@m,KH+HSthZ@@!$!IH%"@#@?S#t%݀@m$' *tc$0) !X}3 + Ȁ`6`- h*i9/EX6;18g<3#P5\v>`58s{>7`@9 8X16xPwx^<u'LӀ` x ^?x2P1?:X\jt`!PZ,6x ހHJp `!vr l @ |LwHgm$PXta^i@ 3S |87UxXqdX0 /Q$?h}` \5  ?`gm dP`4 (=M ;V[ (Jfz% d830EL8K 0m""+`$8&r'817PLRhڀHUL8 f 28/5s F8Pb{}8TՀ Fl#S dnp8z{x+Dр3H2XOi: {hP ow8XX:NTՀpi #f`>T<HoOTՀ0_7Xր`Y6H}(0bn  ?8 t]8+7 tHaXh r8 4 L@  ??p =X@s\"$ X%0 Ls3@E`<X{@0@ Ѐ`3> =@N]y hxpb0P0Ktpf^0̀@y`"x b% i`} '! 83(# @;(% ,t <G*p' ?]rH[D(jh5` ؀H-G` P^t9@X-@O~`gh(h(, |?0PAE8N0]j tP $<π$$/$ 78CKD0ch x` k00h$<Kh8Ap\@#H?P 0[X V@u M 8NV^ r(n ?X f0H!#P0(.IS TZh8cijP Ԁsl"2w($J |&t@` aX(րgk*0t , h.!0B!2n!4v Zc"(6 m "p8`#(:ʀ0#p<܀0%x1P*K XW|(B( DH xFP 8o` ؀P~hh;P(6P/G4J ,ZoX V@{* U ]"i0)L j_t$ H ~ x ^@0 8a~8N 88 Q 88_0  0 @h  " *##2'':)) <++ @//  H33 @P77 `X;;`??hCC!rEE#vGG%zII'~KK)MM+OO(-SSH/WWh1YYx3[[5]]7__9cc;gg=kk ?nn!App"Crr# Euu$0Gxx%@I{{&PK}}'`M(pO)Q*S+U,W-Y.[/]0_1a2c3(e 48g5i <k*>m4@o>(B(qJFPsT0HX3,;u;0 8 &8 '@ +@ 88 8 8 8 8 8 0+Ff Y\~0cn ux+P Ԁ8~0 tV (c0oxH 6  @s(0~X  :f0  H"@? %`!$(p 0 0  #8 @8 8 x3h>(&)H/1h79"?A 0p0&*p+>:PIV/fceLnqsO v@R `vh Zh(X ( Px#) ,./ `*>H*6x%"p(IBPR6?8#BH P%|PE)P#0 <u,A0 8 Hh %@h2C IU7.[aC @(sJx q0 0 ` !|3h;lP` " @+8 )DD8Kcz4(>l: @@R2`]I h( H.O$\$"^ *@*9H ==@ H#H!0 XIX8PE!PFPJPW_< &^l(nB`ofx^0p    Ȁ?0 v 8N((BJpo t1,x?  €H h  ""(" 27k&Xr|Chڀ`M`GXB HmP&84?@<GHDOP HQxW\-!@@Hv% H!(  h'rx:[~bg0 ?0w< h% > [Fzb!*3p:NPVr<z L4!X-!#D`:k$$% tyF#X)1* S  ; Ā0"d D26x^hY p܀  @h!*>@S@ ("@"/@D$€ FJjH*@HR@H00  (<Fh >NOnF[grb0p|0̀` Xh,x5(ʀ  P,(`<qP09p!0l(0*,0hBDH5X( C  0   ( p('J(Uj)@I;`X(h@?@`@0@88 `C1 <@Mh 8(>P0̀@ 6hڀ8"9P0*LG(Qp0L(h2!p!\0<?!#xXNU"x%8dk#'|#)) bP*+ `+P- Ԁ+p/ ܀ +1 (+3 (4:,P5 ?E,7 $(M\-09 Lhnx-; n|~-= v8.? /hA ڀ0 09(%`8-C(JHIl!*0H ( HP !"hb/ B 2HF@  h H} (=ISP p\(-|8h(",B9;MĀ XaO5AXFrbXQ.0H (% (,P60_l pwy t  p    HҀ      ("  A X$VJX/ &t bk;h(8wD*c ,Hy`.X~0b P28%#H8 U|0~N[ ȀcH hx ހk28  zx1tH~   X( !!/s(&= ;p6DhxIgp( &(XKP*Y @O0 T 0QeieTl$HPX(0-=}g u$l 01Uz8(2|0kn ,098D Q83li(J .( U 0'42&8#D#d &$39  RXd N` ؀8T%b$!(. &8&*H04"0:C !$?p '(8(-/ 6` (&-"'H+0x 4; >@EHRpJQR( 8Yul|*@; *= (NeHR r"P5 6 V |k  xh)0P*M8>"DJ((908? H  [ !/P4I $9(%) +2#  01&'0 x-mt>#"8  X(A(-K?aks8?8+H!J  8#.    &+h,\    )/8@@lh` 3: H C 0?0#h     #*0P !%@6l;Dhu8 %/81O`X(U%  J (\p \0lPԀ8* # h), `2 &x)dFbB8Ok 0r&P( ("8 "U# M 6 x^05 8@hxހ msv{  @( ("(!6? h5X=w8H/*P]r @uE 6K{+ lHj+z/)(en@x10 h, u &0 ,3` :>xCI&"#,|9 V bc80k  V~ 0_mKM( (W0K&vSp ܀8 )(:  '("6PP :   4, @ l @|  )@ ) 1@ 1  ,  ,  ,  ,  Oo o $@ $ 6@ 6X H@ H \@ \H m@ m {@ {  ,  , _0O_O@   *@8 5`O*0  , D aO-P aO)bO1@P8 1H F@8 F$ P@8 P Z@8 Z e@l e4 y@  y @!0 # @" ' @% ) @& +H @( - @( /, @) 1 @*\ 3 @* 5 !&@+ 7& #>@, 9> %X@- ;XT 'o@.  =oT )@.t ?T +@. AT -@/ CP /@/l E 1@/ GP 3@/ ID 5@0 8 K 7@0 ML 9 @10 O l ;0@1 S0 =?@1 U? ?P@1 WP A , @ e`Oo o$ &o( 1o, =qoCqpoIo0 Qo4 Zo8 d.@ ko< t.D }.H .L .P .T .X .\ eOo@ oD qo.` @1  $@2 $ :@3 :h R@4 RL j@4P j !y@9 yH #@  .h P '@?p x *@? !\ ,@@D # .@A %}o.l  0 @G ' 8 4,@G )5oH ,` 6;@HT +; 9M@Hl -M ;_@H /_ = ,  fO~0o.p $@I $ 1@K 1 A@L0 A Q@M< QP d@M d s@N sX @N < @P0 X @P  @Q$ 0 @ST !p  , ' hO~po/@ &/D -/H 7/L @/P G~oT@V T, a@Y a n@[ nT {@^ { @_8 l @a\8  @d8 p @ex8 < @e8  @f8 #k|Od @j8 % @k8 ' @l`8 )p "@l8 +x $ ,  kO@nP  @o8 t &@pp & 1@r4 A/ 1 H@r H V@s\ V _@vT _ l@x8 l }@y8 } @y8  @y0 ! @zH # @P %@  ,  u@OoP #@ # 9@ 9 E@d Ex X@8 X o@8 o x@H8 x @   , v OvO@p  (@ ( 0@ 0 :@ : I@8 I| [@8 [l g@8 g r@(8 r` @  @<8 $ @` ! @8 #, @48 %h @8 '  ,  xO~o 1 ,@ 7yO, A@8 AH M@8 M \@8 \ g@8 g r@8 r |@Ǭ8 |P @8  @8  @8 !  ,  |PO2 ~o)o4@  4 @@8 @ J@ذ8 J V@L8 V a@8 aP p@48 p` @8  @|8 h @8 !l  , - pO3@ $3D 1@P 1 E@` E Y@ Y i@ i {@ {X @  @  @8  @l  @H8  @8 ! @8 #p @H8 %$ Al8 'H A )D A8 + ""A 8 -" $1A x8 /1X &AA 8 1A (RA 8 3R * , 7<O3 3 #A #t 1At 1 ?A` ? NA N [Ap [!L dA4 d0 oA58 o, ~A98 ~0 A8 !d A?L8 #P AB8 % AEH8 ' AF@8 ) AG(8 + " AI 8 - D $,AIP8 /,P &:AK 1:L (KAK 3K *]AN8 7]T ,qAP 9q .AP ; 0AQ8 = 2AR ? 4 ,  0OOO)O5POCAS CP PAV8 P `A]8 `X nA`8 n ~Ae8 ~4 An8  An8  Aq8  Ar8 T As8 `  , C OpO8` '8x .8| 9o` God WAu` W dAw8 d$ tA8 t AH8 L A8  A8 D A8  A < A8  A8  A8 # A8 ' A8 )  Ap8 +  "A8 -P $ A`8 / T &/A8 1/ (?A8 3?$ *MA8 5M ,]A8 7] .mAd8 9mL 0|A8 ;|h 2A8 =P 4Ah ?t 6A8 A 8A¼8 C :Aƴ8 E <Ad8 GH >Aɬ8 I @ , * OLOAD  )A8 ) 4 8AP8 8p EA8 E TAD8 T aA8 a` mA\8 m yA<8 y| A8  A8 | A88 ! A8 #$ A8 % A8 'D A8 )` A`8 +8 ! A8 - #A08 / %)A8 1) ' ,  @OOA  )A8 ) 8A8 8p EA8 Eh TA8 T aA8 a pA8 ph  , .  OOA4  -A8 - >Bh8 >l MB8 M ^B 8 ^( mB 8 mP wBD8 wX B8 T B8  B8  B\8 ! B 8 # B,8 %| B8 ' Bp8 )P B8 +` !$B 8 -$P #9Bp8 /9 %LB8 1L 'dB8 3dP )|B8 5| + , ! ǑO!O-B - 8B 8 8@ FB28 F RB48 R cB68 c qB98 q B>T8  BBp8 8 BI8  BL8  BMd8 !, BN8 # BO8 % BP8 'H  , POO"BQ " 3BS8 3D GBV8 G YBX8 Y mB\8 m Ba8  Bbx8  Bd 8 `  ,  0OOBep  -Bf8 - >Bhx8 > MBih8 M ^Bk8 ^$ uBo 8 uh Br8  BsX8 h  , " ODOBt  )BvL8 ) 8Byd8 8 EBzh8 EH TB|8 Tp iB 8 i ~B8 ~ B8  B8  B8  B8 ! B8 # Bp8 % B8 ' B8 )  , OO!Bp ! 1B 8 1, DB88 D UB8 UP hBD8 h yBL8 y B8  B8  B8 X B8 t B8 !t B8 #D BD8 %  ,  OOB@  'B8 ' 5B8 5 AB8 A OB\8 Ox ]B8 ] iBd8 i uBh8 u4 BĜ  B<8  B@ ! B8 % Bʰ8 '  , ) LOPoN (6O1o::XOEoP>OZB Z pBΜ p BX 0 BЈ l B @ B4  B  B  Bٔ8 !O B48 # B8 %l B88 ', Bd8 + ( "-B --| $@B8 /@P & ,  A`ORp Rt )B` )t ;B FR ; MB M ^B8 ^ gBL8 g rB8 r C8  C8  C8 COx C48  C8 !H  , COC@  C @ -C@8 -D  ,  D Oo8o&R 2C 2L >C  >@ QC  `poQ gC  g tC8 t@  , EOC  &C &T 9CP 9t  , F`Oop R &R ,C , 8C 8 CC C  , G OR C@  3C< 3 IC8 I`  ,  GOH$OHDO*o4o<oH8oRR ^Cp ^ kC k {C {p C,  C  C R  C8   , "IOpoS &CP & 5C! 5 HC" H ZC" Z kC" k {C# {, C#  C% L C%P ! C( # C)d %x C)8 '0 C* 8 )o@ C,L8 +  , J`OC.  %C28 % 4C48 4, =C: = NCC8 >x PCx8 P _C48 _\ sCԐ8 s` C8 4 C$8 ` Cل8  Cۄ8 @ C8 ! Cހ8 #| C8 %@  , cOdHO CD8  .C8 .| <CH8 < MC`8 M [C8 [ nC nl |Cd8 | Cp8  Cd8  CP8  C8 ! C8 #  , &f0OfO Cp8  +C8 + 6C8 6 DC8 D OCp8 O _C8 _ kC8 k| vDx8 v DH8  D<8 d D8 !t D8 #X Dl8 %x D 8 '8 D 8 ) D 8 +h !D 8 -< # , i OiO D`8  .Dt8 . <Dl8 < MD8 Md [DX8 [ mD$8 m |D(8 | D,8  D@8  DP8 X D8 ! D8 #D  ,  k0OkOD $ 2D)8 2L @D* @ MD/x M \D1p \ lD2L l vD2h v D3d8   , 3r`OD5@  #D5 #4 2D58 2 >D68 >@ ND7 N aD: aH tD@ t DB8 t DB \ DC ! DD % DD ) DEl + DFL - DH /  DI8 1 H DM8 3 "*DPt8 5*8 $:DQ8 7:4 &PDR 9P( (bDT ;b< *qDWD8 ?q\ ,zDX8 Azl .D^  C 0 , +wPOo "o /o 9o GD^  G YD^ Y iD_<8 i rD`8 r |DaL8 | Dc 8  Dh8  Di8 H Dm 8 ! Dm8 # Dr8 % Dxx 'D Dy ) Dz` + D|8 - "%D} /% $3D 8 13 &=D 5= ( ,  x@OxO"D " /D / ?D8 ?p GD G UD8 Ut ^D,8 ^ jDD8 j |D@ || D ! DD # D8 %  , }OD t $D $0 5DD 5 FDD8 F4 ODx8 O \D08 \ jD8 jl  ,  ~ODP  D\  +D + <D < LD L ZDD Z0 gDt g vD@ v D  D < DT ! DL #Z`  D8 %  , % pOD   Dڬ  3Dd 3 AD݄ A QDߘ Qp dD d, nD4 n yD y D  D  D ! D8 #H D % D ' D8 ) D$ + D / " ,   OOD  /Dp / @D  @ RD R dD< d mD  md }D }x D  D P E !D  , # OEP  #E # 7E 7 KEh K, ^E ^l pE p ~E8 ~( E08  E8 #8 E8 'p Et8 + E|8 / E 48 3 E 8 7, E 8 ;0 E $8 ?  , < @O\` \d "\h ,\l :\p FE  F QE  Q ]E ]8 hEP hH tE t E 4 E P E!8  E$ @ E&   E( !P E*H #| E, %@ E. ' !E/  )4 #E0T +4 %!E1 -! '.E=d /. )<E@ 1<@ +IEC@ 3I -WEE8 5W /bEH8 7b 1iEIl8 ;i 3wEK@8 ?w| 5EK8 A 7EM`8 C 9 ,  pOEN   ,  OEN8 x EP8  %EU 4po>]d F]h %, MEX M  , 0OEZ   E[  )E[ )X  , O] ] -] ;E^P ;, HE`|8 HL XEa X aEb a nEh nD }Ej } , Et, H Ett  Ev8   ,  OExP t  E{  0 /E} /4 AE( A PE P$ ^E@ ^ rE r }E8 }< E8  E l  , ) o o o $o ,o 4E 4 <E|8 < @E8 @ JE8 J SE8 S [E(8 [L cEt8 c< hE8 hh rE8 rx zE8 !zD o o o o E # E\8 % E8 ' "E8 )h $EP8 +` & ,  `OE P E  +E + 8E 8| FE| FP VE V cE c oE o\ {E { E  Et !  ,  OE  E X (ET ( 4E 4$ @E @ NE˜ NP ]E ]| iEh i xEd x E  Eը ! E֨ # Ed8 %(  ,  OEא X E  )Eh )P 8Eݸ 8d DE D, NEH8 N YE8 Yl  ,  OEp   E4   .E .p <E8 <l JE J VEl V cE( c  qE< q ~F08 ~p F ,  , * O`x F  (F ( 5F d 5 @F  @ LF  L XF p X dFl8 d rFX8 r ~F ~D FD 4 F"x ! F' # F' % F*H ', F-t ) F/ +\ !F/ - #F0 / %F2@8 1 ' ,  Oo b +F5@ + 7F6P8 7 DF6 D KF8 K RF9X R [F:$8 [, hF;P8 h  , @OFFH 9> 0LF =L 2RF ?RP 4ZFh AZH 6hF Ch 8yFh GyH :F IX < ,  F h  ,  F  F  'F ' 5F 5 EF E SF S _F _ tF t  , F  F   ,  g0 g4 'g8 1g< @g@ SF S ^ohF08 h F X F0 ` F x F H  ,  o gP gT .gX 9g\ Gg` RFP R dF d x qFp8 qX }F }  ,  F P  ,  g g g #F08 #8 /Fh8 / 7F 7@ DF( D QF QP  , F` P  , v Fð  F  )F ) 8F 8( KF K ZF8 Z eFX e qFx q }FĘ !} FĠ # Fİ % F ' F ) F + F0 - FP /( Fx 1 !Fň 3 #FŘ 5 %FŨ 7 '*FŸ 9* )9F ;9 +HF =H -VF ?V /gF Ag 1sF( Cs 3F8 E 5FH G 7FX I 9Fh K ;Fx M =FƐ Q ?Fư U AF Y CF [ E(F ]( G<F _< IUF aU KkF ck M~F  g~ OF0 k QF@ m SFP o UF` q WFp s YFǀ u [Fǘ w ]FǨ y _FǸ { a*F }* c<F < eOF OH geF0 e( isFX s( k}FȀ }( mFȨ 0 oF ( qF 8 s ,  F@  FP   , FP   ,  F@ P  ,  F֐ x  ,  F x  ,  Fِ   ,  F  p  ,  Fܐ   ,  F  p  ,  Fߐ p  ,  F p  ,  Fp p  , F p  ,  FP p  , F8  FX ` -F - >F >p LF8 L WF W oFP8 o zF8 zH F88 ` F8 P F ! Fx # F@ %h F8 ' FX8 )H  ,  F @  ,  F H F( @  ,  Fp   , FP   ,  F   ,  F   , G   ,  G   , G0 P  , G P  , G   , G x  ,  G    ,  G  p  ,  G  p  , G  8  ,  G   , G` H G  *G * 9G 9  ,  G p G p  ,  G G  'G ' 5G 5 EG E0 SG S` _GX _( vG vH G x  , G@ ( Gh ( 4G 4( BG B8 RG R(  ,  G   ,  G  ,  Gp   ,  G`   , G!p  G"x   ,  G"   ,  G$@   , G&   ,  G(   ,  g G- `  ,  G/ (  ,  G4   ,  G6 P  ,  G7P  G<   ,  G?  h  ,  G@ `  , GA   ,  GC @ GE  3GG 3 CGHH CH TGH Tx lGJ l`  ,  GJp @  , GK @  , GL   , GO   ,  GS p  ,  GVP @  , G\   ,  G^ 8  ,  Gb @ Gc @  , og Gc@8  -GdP8 - 5Ge 5  ,  Gk   , Gl  Gq  "Gr8 " .Gv .P  ,  GwP P  , OGw  Gz0  /GP / ?GH ? NG N  ,  G   ,  G (  ,  G   ,  G   ,  G P  ,  g G` x  ,  G   ,  h G `  ,  G    ,  h G@ `  ,  G8 P G X GH   ,  G  h +G + >G > HGH H SG@ S _GP _ sG s G `  ,  ,  Gp8 p G @ (G 8 ( AG 8 AX SGx8 S` eG e yG8 y@ G8  G  4OG   , POhp 'G ' 5G Ko Nh| 5(  , G  G°  *G * 9G 9  ,  G  'G 'H  ,  G@8 @ Gŀ   ,  G   ,  G G ( (G (  , G0 x  , GȰ  !Gx !@  ,  G   ,  , (  O O)G )0 8G8 8 ?G8 ? LGp8 L [G`8 [@ iG٠8 iH sG8 sp GX8 x G8 p G@8  G 8 ! G8 #  O`OG`8 %  Gx8 '0 G8 )8 !G8 + #G - % , ' ʐOʜOG X ,G ,P >G(8 >X RG8 R [H [ hH8 hh wʨOH8  H8  H 8  H 8 ! h H8 # Hx8 % H8 ' H  +x H8 -( H / "H8 1H $ ,  , % h H8  Hx8  "H8 " +H8 + 8H!P8 8x GH! G [H! [p oH"X o H$ ( H'(8  H+H #h  H3 %h H4`8 ' H5p8 ) H7 8 + H9@ -h  ! , H:`  H?  3H? 3 GH?  G(  ,  H?P  HD`  -HGx - >HKX >( SHK8 Sp ^HK ^ sHM s HN  HO8  OHP  HTP8 ! HV # HW %  ,  ,  , Do i !i 2րO<HY < QHZ Q8 mH[8 m vH^8 v o o Hd8  Hn`8 X Hn8 8 Hp8 8 Hq(8  Hr8 ! Ht8 # Hv %8 Hx( ' H{0 )p !H{ + #-H|8 -- %CH|8 /C 'OHH8 1O( )ZHp 3Z +oH 5o -H0 7( /HX ;X 1H ?` 3H A@ 5HP C 7H E 9Hx G ;H I =H8 K ?H( MP A , H p p   ,  H8 ` H8  )H )(  ,  H  H   ,  H  `  , H  H  )H ) :H : MH M(  , H H 0 .H .P BH8 B( JH@8 J( RHh R fH8 f pH8 pP wH8 wp HP  Hp ! H #x Hh % H ' H )h  , 5 i H8 X $H $0 ?H ?0 \H8 \ yH yP H8 @ HX8  H@8  HP8  H8 ` HP8 !H H8 #0 H8 % HX8 ' Hh8 )  Hx8 + 0 H8 -0 "H8 /x $*HP8 1* &6H 36 (LH8 5L *XH8 7X@ ,dH 9d( .yH ;y 0H8 = 2 ,  H &H8 & 0H8 0 ;Hx8 ; FH8 F( QH88 Q0 \Hh \P pH8 p {H {0 H  H8 !h Hp8 #`  ,  H ( H (  , H  H@/!HD/.HX/5HǬ/AHǸ/ FH QH/^H/kH/xH/H/FT H H/HH/HP/H\/Hd/H/H/ H  H H/H ߀OߊO ,  ,  ,  , HP ( Hx 0 %Hɨ %P 5H 5  , #@ H  0 HP H˘/"H/0H/>H8/LH|/ZH̜/hH͐/vH͠/Hͨ/H/H/H/H/H/H/ H 8 H  ,  , !Hp  Hά/H/&Hϴ/3H/ AH EH@/RHР/_HР/dH/iHѠ/vHѬ/H/H/Hp/HҰ/HҼ/A H H/HX/HX/H@/HL/ Hx/HԌ/%H0/2Hp/@H|/  ,  HՐ   Hլ Hմ/'H/5H/CH(/QHx/_H/mH/qH(/H0/H</HT/Hׄ/Hה/ #P H׸8 @  ,  ,  , H  H/H/'H/4H /BH$/OH8/\HD/iHh/vHـ/~H٨/ H8 8 # H 8 H  , H` | H 4 *H *4 :HD :` HHۤ H  ,  , Hp   , j j o+H܀ +( 8Hݨ 8  , H 8  ,  ,  H 8  , H@ HD/  ,  H` x  , H H/"H//H/D  ,  H0  ,  H  ,  oH   ,  H H@8   ,  H   , p p p p &p$ /H / 6H 6@ ;H@ ;  ,  H` p  , H H/"Hd/)Hl/0Hp/7Ht/  ,  H 0  , H p  , H  HT/@ "H`/ ,  ,  ,  ,  Hp H/H/1H/?H/CH/QH /\H8/gHT/pHT/|H/H/H/H0/HD/H`/H/H/H/H/H(/Hd/   , H H/  ,  H H/  ,  H H/  ,  H H/  ,  H H(/  ,  H0  ,  H H H( @ Hh `  ,  H 8  ,  H HL/H`/(H/2H/?H/LH/YH/aH/nH /vH/|H0/ (  , H@ Hd/"Hx/)H/6H/>H/FH/SH/  ,  H 8 H H HP8   , H  H8/  ,  H@  ,  Oj@ jD @o"Ho)H )H 2H 20 ;H88 ; BH BP KH K  ,  I I/I/ 0  , oI ( I  I8 h  ,  I   ,  I IP  I P !I h !@ )I  ) 2I  2 :I  :h CI8 CP  ,  I 8  ,  I 0  ,  I 0  , OI0  !I !  ,  jP p0 p4 I p8  *I@8 * .I@8 .8 4Ix8 4  ,  j` I    ,  I I/  ,  I  ,  I  ,  I X  ,  I  ,  Ip X  ,  I I/  ,  I I/I/ 0  ,  I  I8/ID/ 0  , IP   ,  I` Ix/  ,  I I/  , I I/  ,  I I/(  , I jp   ,  I    , j I 0 I  h I!8   ,  oI"0 `  ,  I" p  , I# 0  ,  ,  I$0 I$H/  , I$P I$h/  ,  I$p I$/  , I$ I$/  , I$   ,  I$ X I% `  ,  I%   ,  I'@   ,  p@ I(`  I+8 h  ,  I+ `  ,  I+   ,  I-   ,  I/`  ,  I0P I0/I0/0I0/>I0/BI0/PI1/[I1/fI14/oI14/{I1/I1/I1/I2/I2$/I2@/I2x/I2/I2/I2/I3/I3D/   ,  ,  ,  I3p I3/  , I3 I3/  , I3 I3/  , I3 I3/  ,  I3 P  ,  I4@   , I7P 8  , I7 I7/"I7/(  ,  I7 I7/  , I7 I7/  , I8 I8/  ,  I8   ,  I8 8 I8 h  , Oj !j ,I;P ,` ;I= ;H KI=8 KH YI>@ Y gI@ g  , IA  IA8/  ,  IA@    , IAP IAh/  ,  IAp IA/  , IA IA/  , IA IA/  ,  IA IA/  ,  IA IB/  , IB IB(/  , IB0 IBH/  , IBP IBh/  ,  IBp  IB   ,  ,  IB IB/  ,  IB IB/  , IB IB/  ,  k0  OIB P %IC@ %p  , hoIC8  oIFH8 @ 'IF /O7O'  , k I[ (  ,  I]@  0 I]p/I]x I]/@  ,  pP pT pO*I] *` 4I_  ;o4P AIap A HIb`8 H QIc08 QP YId8 Y bIe8 bX iIfh8 pOi wIg`8 !w ~Ig #~  , Il Il/  , Il   , Il   , p` pd Im  #Is8 # H *I~8 * 1I8 1(  ,  I@ X  , I I/  , I x  ,  I@ @  ,  I @  , I I/  ,  I `  ,  I@ 0  , Ip I/  ,  I 8  , I (  ,  I    ,  ,  , I I I0/%ID/2Il/;I/HI/QI/^I/   , ooo,(o4pp > OEk K(oTpx _k hI8 h rI r I(  I X I( ` I @ I !( I % I )  ,  IP p  ,  I `  ,  I`   , I 8 I p "I( " 2IH <Po2  , IP I/*I/7I/DI/QI/^I/kI/xI/I / I( Ih/Ip/I/I/I/I/I/I/I/  ,  ,  ,  I I/I,/,IX/:I/HI/VI/dI@/qIP/~I/I/I/I(/I,/IP/I`/I/I/I/I/I/!I//I/=I,/KID/ ` Y% b%  ,  IP Id/ I/.I/<I/JI/XI /fI/tI,/Ip/I/I/I/I$/IP/Ih/ ( &  ,  I  I(8 @ Ih `  ,  I 0  , I I/  , I  I8/  ,  I@ IX/  , I` Ix/  , I (  ,  I  Ih x I  *I`8 *` 2I 2 <I <0 EI E NI( N  ,  IP p  ,  I I/I/&I4/0IH/=Id/JIx/WI/_I/lI/tI/   ,  I p  ,  I@ I@/ I`/ (  , Ip P  ,  lP PoI  IX 8  , IÐ I/(I /6I/DIĠ/RI/`I/P n&x t( (f  ,  POOI 8 %I %p /Iˈ8 9m@ >O/ GI͠8 G  , Ip IΈ/  ,  Iΐ ( Iθ  IҘ  'I( ' ,`o1I 1 8I 8x @I@ @  ,  I o `  ,  I0  ,  I   ,  I I/  , I I/  ,  I I/  , I x  , I I/  ,                    !#%')+-/13579;= ?AC  !#%'* ,.0469;!=?            "$&                               "$&(*,     "$&(*, .0246           "$&(*,.02468: <>@B     !#%')          !#%')+-                    !                  " $&(                                 !                       "$            "$&                   !#%                    "$&(*, .02      "$&( *                      " $                  "     !#%')+-/13 5 79;                       "$&(                     !#%')                         "$&(*,.02 468: <>                                 !#%')+-/13579;=? A C EGIKMO Q SUWY[]_acegikmoq su                                                                                                                                               !!                                                                  !!             !#%'       "$&       !$              !#%')+-/1 3 579;=?AC                       "$&(*,.024                                                                                                                                                                                                                                                          crt1text.sSTARTFRM__start_moncontrol_mcount_sprocmonstart/jaya/4.0.5/usr/include/regdef.h/jaya/4.0.5/usr/include/asm.hcrt1tinit.swbimport.crcsiddisplaylast_atomSetWindowPropertyGetWindowPropertyLookForClientEventsGetWindowByClassGetWindowNamemainwbi_init.ctkArgv.crcsiddefaultTableTk_ParseArgvPrintUsagespacestkWindow.crcsidinitializeddefChangesdefAttsCreateTopLevelWindowGetScreenNewWindowNameWindowTk_CreateMainWindowTk_CreateWindowTk_CreateWindowFromPathTk_DestroyWindowTk_MapWindowTk_MakeWindowExistTk_UnmapWindowTk_ConfigureWindowTk_MoveWindowTk_ResizeWindowTk_MoveResizeWindowTk_SetWindowBorderWidthTk_ChangeWindowAttributesTk_SetWindowBackgroundTk_SetWindowBackgroundPixmapTk_SetWindowBorderTk_SetWindowBorderPixmapTk_DefineCursorTk_UndefineCursorTk_SetWindowColormapTk_SetWindowVisualDoConfigureNotifyTk_SetClassTk_NameToWindowTk_DisplayNameTk_SetColorModelTk_GetColorModeltkEvent.crcsidtimerQueuereadCountwriteCountexceptCountmasksreadyreadPtrwritePtrexceptPtrnumFdsfileListidleListlastIdlePtridleGenerationpendingPtrgenericListlastGenericPtrgenericHandlersActiveeventMasksrestrictProcrestrictArgeventTracetraceIndexTk_CreateEventHandlerTk_DeleteEventHandlerTk_CreateGenericHandlerTk_DeleteGenericHandlerTk_HandleEventTk_CreateFileHandlerTk_DeleteFileHandlerTk_CreateTimerHandleridTk_DeleteTimerHandlerTk_DoWhenIdleTk_CancelIdleCallTk_DoOneEventdelayedMotionEventeventDelayedTk_MainLoopTk_SleepdelayTk_RestrictEventsTkEventDeadWindowTkCurrentTimetkGet.crcsiduidTableinitializedTk_GetAnchorTk_NameOfAnchorTk_GetJoinStyleTk_NameOfJoinStyleTk_GetCapStyleTk_NameOfCapStyleTk_GetJustifyTk_NameOfJustifyTk_GetUidTk_GetScreenMMTk_GetPixelstkOption.crcsidstackscachedWindowlevelsnumLevelscurLevelserialdefaultMatchTk_AddOptionTk_GetOptionTk_OptionCmdTkOptionDeadWindowParsePriorityAddFromStringReadOptionFileNewArrayExtendArraySetupStackssearchOrderExtendStacksOptionInitClearOptionTreeGetDefaultOptionstkCmds.crcsidTk_AfterCmdAfterProcTk_BindCmdTkBindEventProcallUidTk_DestroyCmdTk_TkCmdTk_TkwaitCmdWaitVariableProcWaitVisibilityProcWaitWindowProcTk_UpdateCmdTk_WinfoCmdTkDeadAppCmdtkFocus.crcsidgeneratedEventPtrTk_CreateFocusHandlerTk_FocusCmdTkFocusFilterEventChangeFocusTopLevelPtrSetFocusNotifyFocusWindowTkFocusDeadWindowtkGrab.crcsidbuttonStatesTk_GrabCmdTk_GrabTk_UngrabTkPointerEventChangeEventWindowMovePointerQueueEventPushTriggerEventTkGrabTriggerProcMovePointer2TkGrabDeadWindowEatGrabEventsQueueGrabWindowChangeFindCommonAncestortkPack.crcsidpackerHashTableinitializedTk_PackCmdsideNamesPackReqProcArrangePackingXExpansionYExpansionGetPackerPackAfterUnlinkDestroyPackerPackStructureProctkPlace.crcsidinitializedmasterTableslaveTableTk_PlaceCmdFindSlaveUnlinkSlaveFindMasterConfigureSlaveRecomputePlacementMasterStructureProcSlaveStructureProcPlaceRequestProctkSelect.crcsidpendingRetrievalspendingIncrsTk_CreateSelHandlerTk_DeleteSelHandlerTk_OwnSelectionTk_ClearSelectionTk_GetSelectionTk_SelectionCmdTkSelDeadWindowSelInitTkSelEventProcSelGetProcSelCvtToXSelCvtFromXConvertSelectionSelRcvIncrProcTkSelPropProcHandleTclCommandSelTimeoutProcIncrTimeoutProcDefaultSelectionLostSelectiontkWm.crcsidfirstWmPtrwmTracingTkWmNewWindowTkWmMapWindowTkWmDeadWindowTkWmSetClassTk_WmCmdTk_SetGridConfigureEventReparentEventComputeReparentGeometryTopLevelEventProcTopLevelReqProcUpdateGeometryInfoUpdateSizeHintsWaitForConfigureNotifyWaitForMapNotifyAdjustPositionUpdateHintsParseGeometryTk_GetRootCoordsTk_CoordsToWindowUpdateVRootGeometryTk_GetVRootGeometryTk_MoveToplevelWindowUpdateWmProtocolsTkWmProtocolEventProctkButton.crcsidclassNamesconfigFlagsconfigSpecsoptionStringsTk_ButtonCmdButtonWidgetCmdDestroyButtonConfigureButtonDisplayButtonButtonEventProcComputeButtonGeometryInvokeButtonButtonVarProcButtonTextVarProctkCanvas.crcsidconfigSpecstypeListallUidcurrentUidnumIdSearchesnumSlowSearchesTk_CanvasCmdCanvasWidgetCmdDestroyCanvasConfigureCanvasDisplayCanvasCanvasEventProcEventuallyRedrawAreaTk_CreateItemTypeInitCanvasStartTagSearchNextItemDoItemFindItemsFindAreaRelinkItemsCanvasBindProcPickCurrentItemCanvasDoEventCanvasBlinkProcCanvasFocusProcCanvasSelectToCanvasFetchSelectionCanvasLostSelectionTkGetCanvasCoordGridAlignCanvasUpdateScrollbarsCanvasSetOriginCanvasTagsParseProcCanvasTagsPrintProctkEntry.crcsidconfigSpecsTk_EntryCmdEntryWidgetCmdDestroyEntryConfigureEntryDisplayEntryInsertCharsDeleteCharsEntrySetValueEntryEventProcGetEntryIndexEntryScanToEntrySelectToEntryFetchSelectionEntryLostSelectionEventuallyRedrawEntryUpdateScrollbarEntryBlinkProcEntryFocusProcEntryTextVarProctkFrame.crcsidconfigSpecsTk_FrameCmdFrameWidgetCmdDestroyFrameConfigureFrameDisplayFrameFrameEventProcMapFrametkListbox.crcsidconfigSpecsTk_ListboxCmdListboxWidgetCmdDestroyListboxConfigureListboxDisplayListboxInsertElsDeleteElsListboxEventProcGetListboxIndexChangeListboxViewChangeListboxOffsetListboxScanToNearestListboxElementListboxSelectFromListboxSelectToListboxFetchSelectionListboxLostSelectionListboxRedrawRangeListboxUpdateVScrollbarListboxUpdateHScrollbarListboxComputeWidthstkMenu.crcsidentryConfigSpecsconfigSpecsTk_MenuCmdMenuWidgetCmdDestroyMenuDestroyMenuEntryConfigureMenuConfigureMenuEntryComputeMenuGeometryDisplayMenuGetMenuIndexMenuEventProcMenuVarProcEventuallyRedrawMenuPostSubmenuActivateMenuEntrytkMenubutton.crcsidconfigSpecsTk_MenubuttonCmdMenuButtonWidgetCmdDestroyMenuButtonConfigureMenuButtonDisplayMenuButtonMenuButtonEventProcComputeMenuButtonGeometryMenuButtonTextVarProctkMessage.crcsidconfigSpecsTk_MessageCmdMessageWidgetCmdDestroyMessageConfigureMessageComputeMessageGeometryDisplayMessageMessageEventProcMessageTextVarProctkScale.crcsidconfigSpecsTk_ScaleCmdScaleWidgetCmdDestroyScaleConfigureScaleComputeScaleGeometryDisplayVerticalScaleDisplayVerticalValueDisplayHorizontalScaleDisplayHorizontalValuePixelToValueValueToPixelScaleEventProcScaleMouseProcSetScaleValueEventuallyRedrawScaletkScrollbar.crcsidconfigSpecsTk_ScrollbarCmdScrollbarWidgetCmdDestroyScrollbarConfigureScrollbarDisplayScrollbarScrollbarEventProcComputeScrollbarGeometryScrollbarPositionScrollbarMouseProcScrollCmdEventuallyRedrawScrollbarNewFieldScrollbarTimerProctkText.crcsidconfigSpecsTk_TextCmdTextWidgetCmdDestroyTextConfigureTextTextEventProcInsertCharsDeleteCharsTextFetchSelectionTkTextLostSelectionTextMarkCmdTkTextSetMarkTextBlinkProcTextScanCmdtkBind.crcsidkeySymTableinitializedmodArraymodTableeventArrayeventTableflagArrayTk_CreateBindingTableTk_DeleteBindingTableTk_CreateBindingTk_DeleteBindingTk_GetBindingTk_GetAllBindingsTk_DeleteAllBindingsTk_BindEventFindSequencemasksGetFieldGetKeySymMatchPatternsExpandPercentsTk_BackgroundErrorInitKeymapInfotkSend.crcsidregistrypendingCommandsTk_RegisterInterpTk_SendCmdserialTkGetInterpNamesSendInitLookupNameSendEventProcAppendPropCarefullyAppendErrorProcTimeoutProcmsgDeleteProcSendRestrictProctkAtom.crcsidTk_InternAtomTk_GetAtomNameAtomInittkColor.crcsidnameTablevalueTableinitializedTk_GetColorTk_GetColorByValueTk_NameOfColorstringTk_FreeColorColorInittkGeometry.crcsidTk_ManageGeometryTk_GeometryRequestTk_SetInternalBordertkPreserve.crcsidrefArrayspaceAvlinUseTk_PreserveTk_ReleaseTk_EventuallyFreetkError.crcsidinitializedTk_CreateErrorHandlerTk_DeleteErrorHandlerErrorProctkBitmap.crcsidgray50_bitsgray25_bitsnameTableidTablepredefTabledataTableinitializedTk_GetBitmapTk_DefineBitmapTk_NameOfBitmapTk_SizeOfBitmapTk_FreeBitmapTk_GetBitmapFromDataautoNumberBitmapInittk3d.crcsidborderTableinitializedTk_Get3DBorderTk_Draw3DRectangleTk_NameOf3DBorderTk_3DBorderColorTk_Free3DBorderTk_SetBackgroundFromBorderTk_GetReliefTk_NameOfReliefTk_Draw3DPolygonTk_Fill3DRectangleTk_Fill3DPolygonBorderInitShiftLineshiftTableIntersecttkConfig.crcsidTk_ConfigureWidgetFindConfigSpecDoConfigTk_ConfigureInfoFormatConfigInfotkFont.crcsidnameTablefontTableinitializedlastFontPtrlastFontStructPtrhexCharsTk_GetFontStructTk_NameOfFontStructstringTk_FreeFontStructFontInitSetFontMetricsTkMeasureCharsTkDisplayCharsTkUnderlineCharstkGC.crcsidvalueTableidTableinitializedTk_GetGCTk_FreeGCGCInittkCursor.crcsidnameTabledataTableidTableinitializedcursorNamesTk_GetCursorTk_GetCursorFromDataTk_NameOfCursorstringTk_FreeCursorCursorInittkCanvArc.crcsidconfigSpecsarcUidchordUidpieSliceUidCreateArcArcCoordsConfigureArcDeleteArcComputeArcBboxDisplayArcArcToPointArcToAreaScaleArcTranslateArcComputeArcOutlineHorizLineToArcVertLineToArcAngleInRangeArcToPostscripttkCanvBmap.crcsidconfigSpecsCreateBitmapBitmapCoordsConfigureBitmapDeleteBitmapComputeBitmapBboxDisplayBitmapBitmapToPointBitmapToAreaScaleBitmapTranslateBitmapBitmapToPostscripttkCanvLine.crcsidarrowShapeOptionconfigSpecsnoneUidfirstUidlastUidbothUidCreateLineLineCoordsConfigureLineDeleteLineComputeLineBboxDisplayLineLineToPointLineToAreaScaleLineTranslateLineParseArrowShapePrintArrowShapeConfigureArrowsLineToPostscriptArrowheadPostscripttkRectOval.crcsidconfigSpecsCreateRectOvalRectOvalCoordsConfigureRectOvalDeleteRectOvalComputeRectOvalBboxDisplayRectOvalRectToPointOvalToPointRectToAreaOvalToAreaScaleRectOvalTranslateRectOvalRectOvalToPostscripttkCanvPoly.crcsidconfigSpecsCreatePolygonPolygonCoordsConfigurePolygonDeletePolygonComputePolygonBboxTkFillPolygonDisplayPolygonPolygonToPointPolygonToAreaScalePolygonTranslatePolygonPolygonToPostscripttkCanvText.crcsidconfigSpecsCreateTextTextCoordsConfigureTextDeleteTextComputeTextBboxDisplayTextTextInsertTextDeleteCharsTextToPointTextToAreaScaleTextTranslateTextGetTextIndexSetTextCursorGetSelTextTextToPostscriptLineToPostscripttkCanvWind.crcsidconfigSpecsCreateWinItemWinItemCoordsConfigureWinItemDeleteWinItemComputeWindowBboxDisplayWinItemWinItemToPointWinItemToAreaScaleWinItemTranslateWinItemWinItemStructureProcWinItemRequestProctkCanvPs.crcsidconfigSpecsTkCanvPostscriptCmdTkCanvPsColorTkCanvPsFontTkCanvPsBitmapTkCanvPsStippleTkCanvPsYTkCanvPsPathGetPostscriptPointstkTextBTree.crcsidTkBTreeCreateTkBTreeDestroyDestroyNodeDeleteSummariesTkBTreeInsertCharsTkBTreeDeleteCharsTkBTreeTagTkBTreeAddAnnotationTkBTreeRemoveAnnotationTkBTreeFindLineTkBTreeNextLineTkBTreeLineIndexTkBTreeStartSearchTkBTreeNextTagTkBTreeCheckRebalanceRecomputeNodeCountsAddToggleToLineChangeNodeToggleCountTkBTreeCharTaggedTkBTreeGetTagsIncCountCheckNodeConsistencyTkBTreeNumLinestkTextDisp.crcsidnumRedisplayslinesRedrawnnumCopiesdamagedCopiesTkTextCreateDInfoTkTextFreeDInfoGetStyleFreeStyleComputeStyleValuesLayoutLineToggleTagUpdateDisplayInfoFreeDLinesDisplayDLineDisplayTextTkTextRedrawRegionTkTextLinesChangedTkTextRedrawTagTkTextRelayoutWindowTkTextSetViewFindDLineTkTextCharAtLoctkTextTag.crcsidtagConfigSpecsTkTextTagCmdTkTextCreateTagFindTagTkTextFreeTagSortTagsTagSortProcChangeTagPriorityTkTextBindProcTkTextPickCurrentTkTextUnpickCurrentTextDoEventtkTextIndex.crcsidTkTextGetIndexTkTextPrintIndexTkTextRoundIndexForwBackForwardCharsBackwardCharsStartEndtkTrig.crcsidTkLineToPointTkLineToAreaTkPolygonToPointTkPolygonToAreaTkOvalToPointTkOvalToAreaTkIncludePointTkBezierScreenPointsTkBezierPointsTkMakeBezierCurveTkMakeBezierPostscriptTkGetMiterPointselevenDegreesTkGetButtPointstclUtil.crcsidTclFindElementTclCopyAndCollapseTcl_SplitListTcl_ScanElementTcl_ConvertElementTcl_MergeTcl_ConcatTcl_StringMatchTcl_SetResultTcl_AppendResultTcl_AppendElementSetupAppendBufferTcl_ResetResultTcl_SetErrorCodeTclGetListIndexTclCompileRegexpregerrortclBasic.crcsidbuiltInCmdsTcl_CreateInterpTcl_DeleteInterpTcl_CreateCommandTcl_DeleteCommandTcl_EvalTcl_CreateTraceTcl_DeleteTraceTcl_AddErrorInfoTcl_VarEvalTcl_GlobalEvaltclHash.crcsidTcl_InitHashTableTcl_DeleteHashEntryTcl_DeleteHashTableTcl_FirstHashEntryTcl_NextHashEntryTcl_HashStatsHashStringStringFindStringCreateOneWordFindOneWordCreateArrayFindArrayCreateBogusFindBogusCreateRebuildTabletclVar.crcsidnoSuchVarisArrayneedArraynoSuchElementtraceActiveTcl_GetVarTcl_GetVar2Tcl_SetVarTcl_SetVar2Tcl_UnsetVarTcl_UnsetVar2Tcl_TraceVarTcl_TraceVar2Tcl_UntraceVarTcl_UntraceVar2Tcl_VarTraceInfoTcl_VarTraceInfo2Tcl_SetCmdTcl_UnsetCmdTcl_AppendCmdTcl_LappendCmdTcl_ArrayCmdTcl_GlobalCmdTcl_UpvarCmdTclDeleteVarsCallTracesNewVarParseSearchIdDeleteSearchesDeleteArrayVarErrMsgpanic.crcsidpanictclGlob.crcsidAppendResultDoGlobTcl_TildeSubststaticBufcurSizecurBufTcl_GlobCmdtclGet.crcsidTcl_GetIntTcl_GetDoubleTcl_GetBooleantclUnixUtil.crcsidwaitTablewaitTableSizewaitTableUsedTcl_EvalFilesigchld_handlerTcl_ForkTcl_WaitPidsTcl_DetachPidsTcl_CreatePipelineTcl_UnixErrorTclMakeFileTableTclGetOpenFiletclParse.crcsidTcl_BackslashTclParseQuotesTclParseNestedCmdTclParseBracesTclParseWordsTclExpandParseValueTclWordEndQuoteEndVarNameEndTcl_ParseVarregexp.cregparseregnparregdummyregcoderegsizeregcompregregbranchregpieceregatomregnoderegcreginsertregtailregoptailreginputregbolregstartpregendpregexecregtryregmatchregrepeatregnexttclCmdAH.crcsidTcl_BreakCmdTcl_CaseCmdTcl_CatchCmdTcl_ConcatCmdTcl_ContinueCmdTcl_ErrorCmdTcl_EvalCmdTcl_ExprCmdTcl_ForCmdTcl_ForeachCmdTcl_FormatCmdtclCmdIL.crcsidTcl_IfCmdTcl_IncrCmdTcl_InfoCmdTcl_JoinCmdTcl_LindexCmdTcl_LinsertCmdTcl_ListCmdTcl_LlengthCmdTcl_LrangeCmdTcl_LreplaceCmdTcl_LsearchCmdTcl_LsortCmdSortCompareProctclProc.crcsidTcl_ProcCmdTclGetFrameTcl_UplevelCmdTclFindProcTclIsProcInterpProcProcDeleteProctclCmdMZ.crcsidTcl_RegexpCmdTcl_RegsubCmdTcl_RenameCmdTcl_ReturnCmdTcl_ScanCmdTcl_SplitCmdTcl_StringCmdTcl_TraceCmdTraceVarProcTcl_WhileCmdtclUnixAZ.crcsidcurrentDirTcl_CdCmdTcl_CloseCmdTcl_EofCmdTcl_ExecCmdTcl_ExitCmdTcl_FileCmdStoreStatDataGetFileTypeTcl_FlushCmdTcl_GetsCmdTcl_OpenCmdTcl_PwdCmdTcl_PutsCmdTcl_ReadCmdTcl_SeekCmdTcl_SourceCmdTcl_TellCmdTcl_TimeCmdCleanupChildrentclEnv.crcsidfirstInterpPtrenvironSizeTclSetupEnvFindVariablesetenvputenvunsetenvEnvTraceProcEnvInittclUnixStr.crcsidTcl_ErrnoIdTcl_SignalIdTcl_SignalMsgtclExpr.crcsidExprParseStringExprLexExprGetValueExprMakeStringExprTopLevelTcl_ExprLongTcl_ExprDoubleTcl_ExprBooleanTcl_ExprStringtclAssem.crcsidTcl_CreateCmdBufTcl_DeleteCmdBufTcl_AssembleCmdTcl_CommandCompleteXIntAtom.cXInternAtomXChProp.cXChangePropertyXGetProp.cXGetWindowPropertyXlibInt.cpadlength_dummy_request_XFlush_XEventsQueued_XReadEvents_XRead_XReadPad_XSendpad_XAllocID_XSetLastRequestRead_XReply_XEatData_EatData32_XEnq_XUnknownWireEvent_XUnknownNativeEvent_XWireToEvent_SysErrorMsg_XDefaultIOError_XPrintDefaultError_XDefaultError_XError_XIOError_XAllocScratch_XVIDtoVisualXFree_XFreeQ_XGetHostname_XScreenOfWindow_XReadV_XWriteVXQuTree.cXQueryTreeXGetHints.cXGetSizeHintsXGetWMHintsXGetZoomHintsXGetNormalHintsXGetIconSizesXGetCommandXGetTransientForHintXGetClassHintXFetchName.cXFetchNameXGetIconNameQuarks.cnextQuarkquarkToStringTablemaxQuarksneverFreeTableneverFreeTableSizeXpermallocnodeTableXrmAllocMoreQuarkToStringTable_XrmInternalStringToQuarkXrmStringToQuarkXrmUniqueQuarkXrmQuarkToStringXOpenDis.clock_dummy_requestxauth_namelenxauth_namexauth_datalenxauth_dataXSetAuthorizationXOpenDisplayOutOfMemory_XFreeDisplayStructureXDestWind.cXDestroyWindowContext.cDspArraynumDsplastdspResizeTableFindDspXSaveContextXFindContextXDeleteContextXMapWindow.cXMapWindowXMacros.cXConnectionNumberXRootWindowXDefaultScreenXDefaultRootWindowXDefaultVisualXDefaultGCXBlackPixelXWhitePixelXAllPlanesXQLengthXDisplayWidthXDisplayHeightXDisplayWidthMMXDisplayHeightMMXDisplayPlanesXDisplayCellsXScreenCountXServerVendorXProtocolVersionXProtocolRevisionXVendorReleaseXDisplayStringXDefaultDepthXDefaultColormapXBitmapUnitXBitmapBitOrderXBitmapPadXImageByteOrderXNextRequestXLastKnownRequestProcessedXScreenOfDisplayXDefaultScreenOfDisplayXDisplayOfScreenXRootWindowOfScreenXBlackPixelOfScreenXWhitePixelOfScreenXDefaultColormapOfScreenXDefaultDepthOfScreenXDefaultGCOfScreenXDefaultVisualOfScreenXWidthOfScreenXHeightOfScreenXWidthMMOfScreenXHeightMMOfScreenXPlanesOfScreenXCellsOfScreenXMinCmapsOfScreenXMaxCmapsOfScreenXDoesSaveUndersXDoesBackingStoreXEventMaskOfScreenXScreenNumberOfScreenXDestroyImageXGetPixelXPutPixelXSubImageXAddPixelXNoOpXWindow.cXCreateWindow_XProcessWindowAttributesXReconfWin.cXConfigureWindowXUnmapWin.cXUnmapWindowXMoveWin.cXMoveWindowXChWindow.cXResizeWindowXConfWind.cXMoveResizeWindowXBdrWidth.cXSetWindowBorderWidthXChWAttrs.cXChangeWindowAttributesXBackgnd.cXSetWindowBackgroundXPmapBgnd.cXSetWindowBackgroundPixmapXBorder.cXSetWindowBorderXPmapBord.cXSetWindowBorderPixmapXDefCursor.cXDefineCursorXChCmap.cXSetWindowColormapXKeyBind.cKeyCodetoKeySymXKeycodeToKeysymXKeysymToKeycodeXLookupKeysymInitModMapXRefreshKeyboardMappingInitializeXConvertCaseXTranslateKeyXTranslateKeySymXLookupStringXRebindKeysym_XFreeKeyBindingsFindKeyCodeComputeMaskFromKeytransXFlush.cXFlushXPending.cXEventsQueuedXPendingXChkIfEv.cXCheckIfEventXNextEvent.cXNextEventXSync.cXSyncXQuPntr.cXQueryPointerXGrPointer.cXGrabPointerXGrKeybd.cXGrabKeyboardXUngrabPtr.cXUngrabPointerXUngrabKbd.cXUngrabKeyboardXPutBEvent.cXPutBackEventXSetSOwner.cXSetSelectionOwnerXConvSel.cXConvertSelectionXDelProp.cXDeletePropertyXSelInput.cXSelectInputXSendEvent.cXSendEventStrToText.cXStringListToTextPropertySetTxtProp.cXSetTextPropertyXSetWMNameXSetWMIconNameXSetWMClientMachineXStName.cXStoreNameXSetIconNameXSetHints.cXSetSizeHintsXSetWMHintsXSetZoomHintsXSetNormalHintsXSetIconSizesXSetCommandXSetStandardPropertiesXSetTransientForHintXSetClassHintPropAlloc.cXAllocSizeHintsXAllocStandardColormapXAllocWMHintsXAllocClassHintXAllocIconSizeIconify.cXIconifyWindowWithdraw.cXWithdrawWindowXTrCoords.cXTranslateCoordinatesXGetGeom.cXGetGeometrySetNrmHint.cXSetWMSizeHintsXSetWMNormalHintsXWinEvent.cXWindowEventXCrPixmap.cXCreatePixmapXCopyPlane.cXCopyPlaneXText.cXDrawStringXFillRect.csizeXFillRectangleXFillPoly.cXFillPolygonXCopyArea.cXCopyAreaXFreePix.cXFreePixmapXTextExt.cXTextExtentsXTextWidthXClear.cXClearWindowXRaiseWin.cXRaiseWindowXClearArea.cXClearAreaXModMap.cXGetModifierMappingXSetModifierMappingXNewModifiermapXFreeModifiermapXInsertModifiermapEntryXDeleteModifiermapEntryXGrServer.cXGrabServerXUngrabSvr.cXUngrabServerXGetAtomNm.cXGetAtomNameXLookupCol.cXLookupColorXGetColor.cXAllocNamedColorXParseCol.cXParseColorXGetHColor.cXAllocColorXFreeCols.cXFreeColorsXErrHndlr.cXSetErrorHandlerXSetIOErrorHandlerXRdBitF.chexTableinitializedinitHexTableNextIntXReadBitmapFileXCrBFData.cXCreateBitmapFromDataXFont.cXLoadQueryFontXFreeFont_XQueryFontXQueryFontXGetFProp.cXGetFontPropertyXCrGC.cinitial_GCXCreateGC_XGenerateGCList_XUpdateGCCache_XFlushGCCacheXGContextFromGCXFreeGC.cXFreeGCXLoadFont.cXLoadFontXCrGlCur.cXCreateGlyphCursorXCrCursor.cXCreatePixmapCursorXFreeCurs.cXFreeCursorXFillArc.csizeXFillArcXDrArc.cXDrawArcXDrLine.csizeXDrawLineXDrLines.cXDrawLinesXDrRect.csizeXDrawRectangleXGetImage.cOnesXGetImageXGetSubImageXShmTrans.c_XShmFastBcopy_dummy_request_XShmCompatBufCopy_XShmInit_XShmFlush_XShmEndBuf_XShmWaitForNotFull_XShmRealAlloc_XShmSendDataglobals.cXConnDis.ccopystring_XConnectDisplayMakeUNIXSocketConnectionMakeTCPConnectionMakeSHMConnection_XDisconnectDisplayANYSET_XWaitForWritable_XWaitForReadablepadlength_XSendClientPrefixXErrDes.c_XErrorList_XErrorListSizeXGetErrorTextXGetErrorDatabaseTextdbinitializedGetTxtProp.cXGetTextPropertyXGetWMNameXGetWMIconNameXGetWMClientMachineTextToStr.cXTextPropertyToStringListXFreeStringListAuGetAddr.cbinaryEqualXauGetAuthByAddrAuDispose.cXauDisposeAuthXSynchro.c_XSyncFunctionXSynchronizeXSetAfterFunctionXFreeEData.c_XFreeExtDataXGetPntMap.cXGetPointerMappingXGetKeyboardMappingXEvToWire.c_XEventToWireevtomask.cXPutImage.c_reverse_byte_reverse_nibs_Reverse_BytesNoSwapSwapTwoBytesSwapThreeBytesSwapFourBytesSwapWordsSwapNibblesShiftNibblesLeftSwapBitsSwapBitsAndTwoBytesSwapBitsAndFourBytesSwapBitsAndWordsSwapFunctionHalfOrderSendXYImageSendZImagePutImageRequestPutSubImageXPutImageXImUtil.c_lomask_himask_XGetScanlinePad_XGetBitsPerPixel_normalizeimagebits_putbitsXCreateImage_XDestroyImagelow_bits_table_XGetPixel_XGetPixel8_XGetPixel1_XPutPixel_XPutPixel8_XPutPixel1_XSubImage_XSetImage_XAddPixel_XInitImageFuncPtrs_XReportBadImagemp_def.cusinit.c_uslifsplockfunsplockfgetlockclean_tidmapany_valid_tids_libX_int__usgetpid_libX_int__usgettid_libX_int__usclean_tidmap_libX_int__usaddmeinit_mapfile_libX_int_usinittryufd_libX_int__usretsfd_uscreatesfd_usgetsfdhdr_init_libX_int__uprintsetappendusconfig.c_libX_int_usconfig_libX_int_usputinfo_libX_int_usgetinfo_libX_int_uscasinfousemas.c_libX_int__Psema_libX_int__CPsema_libX_int__Vsema_libX_int_ustestsemapgtoscount_libX_int_usinitsema_libX_int_usnewsema_libX_int_usfreesemahlogops_libX_int_usopenpollsema_usfindspfd_libX_int__usblock_libX_int__usunblockhooks.s./usrename.hXrm.cXrmQStringresourceQuarksmaxResourceQuark_xrmtypesXrmStringToQuarkListXrmStringToBindingQuarkListPutEntryGetEntrynumTableslenTablesGetTablesNewDatabaseEnumEnumerateDatabasePrintBindingQuarkListDumpEntryMergeXrmQGetSearchListXrmQGetSearchResourceXrmQPutResourceXrmPutResourceXrmQPutStringResourceGetDatabaseReadInFileXrmPutStringResourceXrmPutLineResourceXrmGetStringDatabaseXrmGetFileDatabaseXrmPutFileDatabaseXrmMergeDatabasesXrmQGetResourceXrmGetResourceXrmInitializeXrmDestroyDatabaseSameValue_XrmGetResourceNameAuFileName.cXauFileNamebufbsizeAuRead.cread_shortread_counted_stringXauReadAuth_oserror.c_libX_int__oserror_libX_int__setoserrorsyncinit.c_libX_int__syncinitmpport.c_libX_int_abort_libX_int_mpin_libX_int_munpin_libX_int_vsprintf_libX_int_getdtablesizemalloc.c_libX_int__lmalloc_libX_int__lfree_libX_int__lreallocaddheadaddtail_libX_int__lmalloptfreespacecheckqadefgrow_libX_int_acreate_libX_int_amalloc_libX_int_afree_libX_int_arealloc_libX_int_amallopt_libX_int_acallochlocks.c_ushlockdefspinbuildname_libX_int__ushardlock_init_libX_int__ushardlock_create_libX_int__ushardlock_attach_libX_int__ushardlock_detachhardlock_addpage_hnewlock_hinitlock_hfreelock_hwsetlock_hcsetlock_htestlock_hsetlock_hunsetlock_hdumplock_hctllock_dhnewlock_dhinitlock_dhfreelock_libX_int__dhwsetlock_dhcsetlock_dhtestlock_libX_int__dhsetlock_libX_int__dhunsetlock_dhdumplockulocks.c_libX_int__ussoftlocks_init_snewlock_sinitlock_sfreelock_swsetlock_stestlock_libX_int__sctllock_sdumplock_libX_int__dssetlock_libX_int__dsunsetlock_dscsetlockdodscsetlockusmalloc.c_libX_int_usmalloc_libX_int_usfreecaslck.s_ssetlock1$00000000002$0000000000lockedwokealreadyberr_scsetlock4$00000000001$00000000012$00000000013$00000000005$0000000000_sunsetlockunagain1$00000000022$00000000023$0000000001waiternotasleepunberr_scas_hcas1$0000000003_setname_unsetname./us.h/puppy/bvd/usr/include/errno.h/puppy/bvd/usr/include/sys/prctl.hbit.c_libX_int_bset_libX_int_bclr_libX_int_bfclr_libX_int_bftstsetatan.satan2stratanatan2atan010$000000000020$000000000030$000000000040$000000000070$000000000072$000000000074$000000000078$000000000080$000000000082$000000000084$000000000086$000000000090$000000000091$0000000000setup_atan2_error/syda/sherwood/310_root/usr/include/svr4_math.htrig.scos1$00000000008$00000000009$000000000099$0000000000sin1$00000000012$0000000000sin1cos14$00000000005$00000000006$00000000008$00000000019$000000000199$000000000111$0000000000tan1$00000000022$00000000013$00000000004$00000000015$00000000016$00000000018$00000000029$000000000299$000000000211$0000000001hypot.s__z_abs___hypot1$000000000010$000000000011$000000000012$000000000013$000000000014$0000000000ret15$000000000020$000000000022$000000000070$000000000075$000000000099$0000000000hypotstrset_hypot_err/syda/sherwood/310_root/usr/include/values.h./sgi_libm.hsqrt.ssqrt2$00000000003$00000000005$000000000055$00000000006$00000000007$00000000008$00000000009$0000000000retQNaN1$0000000000denorm_sqrtsqrtstrset_sqrt_errsvr4_err.c__set_arg_val__gamma_err_val__hypot_err_val__set_res_val__set_err_vallibm_vals.sgen/stubfpestart.c__readenv_sigfpectype.cdefl_cclassfirst_callcur_chrtbl_setchrclass_setCchrclassgen/cuexit.cexitdata.cstrtol.cstrtolgen/strlen.sstrlen1$0000000000sprintf.csprintfgen/strcmp.sstrcmp1$00000000002$00000000003$0000000000fprintf.cfprintfstrncmp.cstrncmpstrtod.cmybufstrtodgetenv.cgetenvnvmatchstrtoul.cstrtoulmalloc.callocsallocpalloctallocxallocendmallocfreereallocstrncpy.cstrncpygen/strcpy.sstrcpy1$0000000000$doch3$doch2$doch1$doch0strrchr.cstrrchrsys/gettimeday.cgettimeofdaysys/signal.ssignal1$0000000000ninvalid/jaya/4.0.5/usr/include/sys.s/jaya/4.0.5/usr/include/sys/signal.h/jaya/4.0.5/usr/include/sys/syscall.hgen/bcopy.smemcpygoforwardsforwards_bytecopy99$0000000000retforwalignableforw_copy2forw_copy3forwardsforwards_32forwards_16forwards_4gobackwardsbackwards_bytecopy99$0000000001backalignableback_copy2back_copy3backwardsbackwards_32backwards_16backwards_4sys/select.sselect9$0000000000sys/open.sopen9$0000000000sys/fstat.sfstat9$0000000000sys/close.sclose9$0000000000sys/read.sread9$0000000000printf.cprintfscanf.cscanffscanfsscanfstrchr.cstrchrgen/bcmp.smemcmpwordcmp1$0000000000unalgncmp1$0000000001partaligncmp1$0000000002bytecmp1$0000000003cmpdonecmpne9$0000000000gen/memset.smemset1$0000000000blkset1$0000000001wordsetbyteset1$0000000002setdonefopen.cfopenfreopen_endopensys/getuid.sgetuid9$0000000000getpwuid.cgetpwuidgetpwent.cPASSWDEMPTYpwflinepasswdsetpwentendpwentpwskipgetpwentfgetpwentsys/time.stime9$00000000001$0000000000ctime.ccbufctimeasctimect_numbfgets.cfgetsflsbuf.c_cleanupfclosefflush_flsbuf_xflsbuf_wrtchk_findbuf_bufsyncfputs.cfputstoupper.ctouppertolower.ctolowerstrcasecmp.ccharmapstrcasecmpstrncasecmpqsort.cqsbufqsesqscmpqsortqsbufsizeqs1qsexcqstexcabort.cpassabortsys/stat.sstat9$0000000000opendir.copendirreaddir.creaddirclosedir.cclosedirgetpwnam.cgetpwnamstrcat.cstrcatsys/wait3.swait39$0000000000sys/fork.sfork9$0000000000parentsys/wait.swait9$00000000001$0000000000gen/mktemp.smktempsys/write.swrite9$0000000000sys/lseek.slseek9$0000000000sys/unlink.sunlink9$0000000000sys/pipe.sFRMSIZEpipe9$0000000000dup2.cdup2openmaxsys/exit.s_exitexecvp.cshellexeclpexecvpexecatstrerror.cebufstrerrorstrcspn.cstrcspnatoi.catoimp_def.csys/chdir.schdir9$0000000000sys/access.saccess9$0000000000sys/lstat.slstat9$0000000000sys/readlink.sreadlink9$0000000000sys/geteuid.sgeteuidsemlibc.c_semgetc_semputcfilbuf.c_filbuffdopen.cfdopengetwd.cpathsizegetwdprependfputc.cfputcfread.cfreadfseek.cfseekftell.cftellgen/bcopy.sbcopygoforwardsforwards_bytecopy99$0000000000retforwalignableforw_copy2forw_copy3forwardsforwards_32forwards_16forwards_4gobackwardsbackwards_bytecopy99$0000000001backalignableback_copy2back_copy3backwardsbackwards_32backwards_16backwards_4errlst.cerr_data.csys/ioctl.sioctl9$0000000000sys/gethostnm.sgethostname9$0000000000sys/recvmsg.srecvmsg9$0000000000sys/sendmsg.ssendmsg9$0000000000calloc.ccallocfwrite.cfwriteffs.cffsgen/rindex.srindex1$00000000002$0000000000sys/fcntl.sfcntl9$0000000000sys/socket.ssocket9$0000000000sys/connect.sconnect9$0000000000sleep.csleepin_addr.cinet_addrinet_isaddrgethostwrap.cfuncsinitializedseparators_setresordsubrsethostresorder_resorderinitgethostbynamegethostbyaddrsys/setsockopt.ssetsockopt9$0000000000gen/bzero.sbzerosys/ftruncate.sftruncate9$0000000000sys/mmap.smmap9$0000000000sys/munmap.smunmap9$0000000000sys/fchmod.sfchmod9$0000000000sys/chmod.schmod9$0000000000sys/prctl.sprctl9$0000000000sys/pagelock.spagelock9$0000000000sys/ulimit.sulimit9$0000000000sys/sginap.ssginap9$0000000000_oserror.c_oserror_setoserrorgen/__infinity.ssys/_open.s_open9$0000000000sys/_read.s_read9$0000000000sys/_close.s_close9$0000000000atexit.c__nextfn__exit_fnsatexit__call_exitfnsdoprnt.cbufcvt_bufendtab_lowdigit_doprnt_blanks_zeroesatof.cinfinityatofsys/_sbrk.s_sbrkerr_brk1$0000000000time_comm.cstart_dstend_dstmonth_sizelocaltimegmtimextime_tzsetgetznamegettimegetdigitgetdstgetusadaytabsunday_legaltimesys/BSD_getime.sBSD_getime9$0000000000crt/cerror.s_cerrorsys/sigtramp.s_sigtrampdoscan.cchcountflag_eof_doscannumberstringsetupfindiop.c_findiopsys/_lseek.s_lseek9$0000000000rew.crewindmemchr.cmemchrmemccpy.cmemccpysys/_write.s_write9$0000000000_isatty.c_isattysys/raise.craisesys/getdents.sgetdents9$0000000000_mktemp.c_mktempsys/getdtabsz.cgetdtablesizesys/execv.sexecv_err_data.c_errlst.cgen/_bzero.s_bzero_blkclrblkzero1$0000000000wordzero1$0000000001bytezero1$0000000002zerodonegethostnam.ch_addr_ptrshosthost_aliaseshostbufhost_addrHOSTDBhostfhostaddrhost_addrsstayopengetanswer_inet_atohtent_gethostbyname_named_gethostbyaddr_named_sethtent_endhtent_gethtent_gethtbyname_gethtbyaddrstrtok.cstrtoksaveptres_init.cres_initisdigit.cisdigitres_query.cres_queryres_searchres_querydomainhostaliasabufgen/_fp_class.s_fp_class_d1$00000000002$00000000003$00000000004$00000000005$00000000006$00000000007$00000000008$00000000009$0000000000_fp_class_f1$00000000012$00000000013$00000000014$00000000015$00000000016$00000000017$00000000018$00000000019$0000000001/jaya/4.0.5/usr/include/fp_class.h/jaya/4.0.5/usr/include/sys/softfp.hgen/dtoa.s_dtoa1$00000000002$000000000015$000000000099$000000000016$000000000019$00000000003$00000000004$00000000005$000000000055$00000000006$00000000007$000000000075$00000000008$00000000009$000000000010$000000000011$000000000040$000000000012$000000000013$000000000014$000000000020$000000000022$000000000023$0000000000infinitynangen/atod.s_atod10$000000000011$000000000012$000000000020$000000000021$000000000022$000000000023$000000000024$000000000029$000000000025$000000000026$000000000028$000000000027$000000000040$000000000050$0000000000infinitymktime.cmktimeCheckForLeap_isleapyearungetc.cungetcsys/_ioctl.s_ioctl9$0000000000sys/_getpid.s_getpid9$0000000000sys/_kill.s_kill9$0000000000sys/_access.s_access9$0000000000sys/_execv.sFRMSIZE_execvres_comp.cdn_expanddn_compdn_skipnamedn_find_getshort_getlongputshortputlongstrpbrk.cstrpbrkgen/bcmp.sbcmpwordcmp1$0000000000unalgncmp1$0000000001partaligncmp1$0000000002bytecmp1$0000000003cmpdonecmpnestrspn.cstrspngen/index.sindex1$00000000002$0000000000res_mkquery.cres_mkqueryres_send.csno_addrres_send_res_closegen/tenscale.s_tenscale10$000000000011$000000000012$000000000013$000000000020$000000000021$0000000000_pten_ptenround_ptenexp_cftime.clanguage__cftime_cftime_ascftimesetcftimeostrpathnameitoasys/_execve.s_execve9$0000000000res_debug.cp_queryfp_queryp_cdnamep_rrnbufp_typep_classp_timein_ntoa.cinet_ntoabperror.cperrorwritev.cwritevsys/send.ssend9$0000000000sys/sendto.ssendto9$0000000000sys/recv.srecv9$0000000000gen/dwmultu.s_dwmultusys/_fstat.s_fstat9$0000000000crtninit.s_environenviron__Argc__Argverrno__start_gp__istart__readenv_sigfpe_setchrclassmainexit_moncontrol_mcount_sprocmonstart_iobtcltkWinwbi_initTK_InitdispargallargSetWindowPropertyTcl_AppendResultstrtolXInternAtomstrlenXChangePropertyGetWindowPropertyXGetWindowPropertyXFreeLookForClientEventssprintfTcl_VarEvalGetWindowByClassXQueryTreeXGetClassHintstrcmpTcl_AppendElementGetWindowNameXFetchNameTcl_CreateInterpTk_ParseArgvTk_CreateMainWindowfprintfTk_SetClassTcl_CreateCommandTk_CreateGenericHandlerTk_MapWindowstrncmpTk_GetUidstrtodTk_AddOption_ctypetk_NumMainWindowstkWindowContexttkDisplayListtkActiveUidtkDisabledUidtkNormalUidcommandsTk_AfterCmdTk_BindCmdTk_DestroyCmdTk_FocusCmdTk_GrabCmdTk_OptionCmdTk_PackCmdTk_PlaceCmdTk_SelectionCmdTk_TkCmdTk_TkwaitCmdTk_UpdateCmdTk_WinfoCmdTk_WmCmdTk_ButtonCmdTk_CanvasCmdTk_EntryCmdTk_FrameCmdTk_ListboxCmdTk_MenuCmdTk_MenubuttonCmdTk_MessageCmdTk_ScaleCmdTk_ScrollbarCmdTk_TextCmdXrmUniqueQuarkTk_DestroyWindowTkWmNewWindowgetenvstrtoulXOpenDisplaymallocstrncpyTk_CreateFileHandlerstrcpyfreeTcl_InitHashTableTk_CreateBindingTableTk_RegisterInterpTcl_SetResultTcl_SetVarTk_CreateWindowTk_CreateWindowFromPathstrrchrTk_NameToWindowTk_MakeWindowExistTk_HandleEventXDestroyWindowXDeleteContextpanicTkEventDeadWindowTkFocusDeadWindowTkOptionDeadWindowTkSelDeadWindowTkWmDeadWindowTkGrabDeadWindowTk_DeleteAllBindingsTcl_DeleteHashEntryTkDeadAppCmdTcl_DeleteHashTableTk_DeleteBindingTableTkWmMapWindowXMapWindowXRootWindowXCreateWindowXSaveContextXConfigureWindowTk_UnmapWindowXUnmapWindowTk_ConfigureWindowTk_MoveWindowXMoveWindowTk_ResizeWindowXResizeWindowTk_MoveResizeWindowXMoveResizeWindowTk_SetWindowBorderWidthXSetWindowBorderWidthTk_ChangeWindowAttributesXChangeWindowAttributesTk_SetWindowBackgroundXSetWindowBackgroundTk_SetWindowBackgroundPixmapXSetWindowBackgroundPixmapTk_SetWindowBorderXSetWindowBorderTk_SetWindowBorderPixmapXSetWindowBorderPixmapTk_DefineCursorXDefineCursorTk_UndefineCursorTk_SetWindowColormapXSetWindowColormapTk_SetWindowVisualTkWmSetClassTk_DisplayNameTk_SetColorModelTk_GetColorModeltkEventDebugTk_CreateEventHandlerTk_DeleteEventHandlerTk_DeleteGenericHandlerTkGrabTriggerProcXRefreshKeyboardMappingXFindContextTkSelPropProcTkFocusFilterEventTk_GetRootCoordsTkPointerEventTkSelEventProcTk_InternAtomTkWmProtocolEventProcTkBindEventProcTk_DeleteFileHandlerTk_CreateTimerHandlergettimeofdayTk_DeleteTimerHandlerTk_DoWhenIdleTk_CancelIdleCallTk_DoOneEventXFlushXEventsQueuedsignalXNoOpXCheckIfEventXNextEventmemcpyselectTk_MainLoopTk_SleepTk_RestrictEventsTkCurrentTimeTk_GetAnchorTk_NameOfAnchorTk_GetJoinStyleTk_NameOfJoinStyleTk_GetCapStyleTk_NameOfCapStyleTk_GetJustifyTk_NameOfJustifyTk_GetScreenMMTk_GetPixelsTk_GetOptionTcl_TildeSubstopenfstatclosereadTcl_DeleteInterpTcl_GetIntTcl_ConcatTcl_ResetResultTcl_GlobalEvalTk_BackgroundErrorTk_DeleteBindingTk_CreateBindingTk_GetBindingTk_GetAllBindingsTk_BindEventTcl_TraceVarTcl_UntraceVarXSyncTk_GetAtomNameTcl_MergeTk_CoordsToWindowTkGetInterpNamesTk_GetColorTk_FreeColorTk_GetVRootGeometryTk_CreateFocusHandlerTk_GrabTk_UngrabXQueryPointerXGrabPointerXGrabKeyboardXUngrabPointerXUngrabKeyboardXPutBackEventTk_ManageGeometryTk_PreserveTk_GeometryRequestTk_ReleaseTcl_SplitListTk_EventuallyFreeTcl_GetDoubleTk_CreateSelHandlerTk_DeleteSelHandlerTk_OwnSelectionXSetSelectionOwnerTk_ClearSelectionTk_GetSelectionXConvertSelectionXDeletePropertyTk_CreateErrorHandlerXSelectInputXSendEventTk_DeleteErrorHandlerXStringListToTextPropertyXSetWMNameXSetIconNameXSetTransientForHintXSetCommandXSetWMClientMachineTk_FreeBitmapXAllocClassHintXSetClassHintTcl_GetBooleanTk_SetGridTk_NameOfBitmapTk_GetBitmapXIconifyWindowXWithdrawWindowprintfXTranslateCoordinatesXGetGeometryXAllocSizeHintsXSetWMNormalHintsXWindowEventXSetWMHintsTk_MoveToplevelWindowTcl_AddErrorInfoTk_SetBackgroundFromBorderTk_ConfigureInfoTk_Free3DBorderTk_FreeFontStructTk_FreeGCTk_FreeCursorTk_ConfigureWidgetTk_3DBorderColorTk_GetGCTcl_GetVarXCreatePixmapTk_Fill3DRectangleTk_SizeOfBitmapXCopyPlaneXDrawStringTk_Draw3DRectangleXFillRectangleXFillPolygonTk_Fill3DPolygonTk_Draw3DPolygonXCopyAreaXFreePixmapTcl_DeleteCommandXTextExtentsXTextWidthTk_SetInternalBorderTcl_TraceVar2Tcl_GetVar2Tcl_SetVar2tkCanvasTagsOptionTkArcTypeTkBitmapTypeTkLineTypeTkOvalTypeTkPolygonTypeTkRectangleTypeTkTextTypeTkWindowTypeTkGetCanvasCoordTkCanvPostscriptCmdTk_CreateItemTypeTkMeasureCharsTkDisplayCharssscanfXClearWindowXRaiseWindowTkUnderlineCharsTcl_StringMatchXClearAreatkBTreeDebugtkTextCharUidtkTextDisabledUidtkTextNoneUidtkTextNormalUidtkTextWordUidTkBTreeCreateTkTextCreateDInfoTkTextSetViewTkTextCreateTagTkTextSetMarkTkTextBindProcTkTextGetIndexTkBTreeFindLineTkBTreeNextLineTkTextPrintIndexTkTextTagCmdTkBTreeNumLinesTkBTreeDestroyTcl_FirstHashEntryTkTextFreeTagTcl_NextHashEntryTkTextFreeDInfoTkBTreeStartSearchTkBTreeNextTagTkTextLostSelectionTkTextRelayoutWindowTkTextRedrawRegionTkBTreeLineIndexTkTextLinesChangedTkTextRoundIndexTkBTreeInsertCharsTkTextUnpickCurrentTkBTreeDeleteCharsTkBTreeCharTaggedTkTextRedrawTagTkBTreeTagTkBTreeRemoveAnnotationTkBTreeAddAnnotationkeyArraystrchrmemcmpXKeycodeToKeysymXLookupStringTcl_ScanElementTcl_ConvertElementXGetModifierMappingXGrabServerXUngrabServerTk_SendCmdXGetAtomNameXLookupColorXAllocNamedColorXParseColorXAllocColorTk_GetColorByValueTk_NameOfColorXFreeColorsXSetErrorHandler_XDefaultErrorXReadBitmapFileXCreateBitmapFromDataTk_DefineBitmapTk_GetBitmapFromDataTk_Get3DBorderTk_NameOf3DBorderTk_GetReliefTk_NameOfReliefatancosTk_GetFontStructTk_GetCursorTk_NameOfFontStructTk_NameOfCursorXLoadQueryFontXFreeFontXGetFontPropertymemsetXCreateGCXFreeGCXLoadFontXCreateGlyphCursorXCreatePixmapCursorTk_GetCursorFromDataXFreeCursorTkIncludePointXFillArcXDrawArcXDrawLineTkFillPolygonatan2TkOvalToPointhypotTkPolygonToPointTkLineToPointsinTkPolygonToAreaTkLineToAreaTkGetButtPointssqrtTkCanvPsYTkCanvPsColorTkCanvPsStippleTkCanvPsPathTkCanvPsBitmapTkGetMiterPointsTkMakeBezierCurveXDrawLinesTkOvalToAreaTkMakeBezierPostscriptXDrawRectangleTkCanvPsFontfopenTcl_UnixErrorgetuidgetpwuidendpwenttimectimefgetsfclosefputstouppertolowerstrncasecmpXGetImageTkBTreeCheckTkBTreeGetTagsTkTextPickCurrentTkTextCharAtLocqsortTkBezierScreenPointsTkBezierPointstclRegexpErrorTclFindElementTcl_BackslashTclCopyAndCollapseTcl_SetErrorCodeTclGetListIndexTclCompileRegexpregcompregerrortclTypeTableTcl_AppendCmdTcl_ArrayCmdTcl_BreakCmdTcl_CaseCmdTcl_CatchCmdTcl_ConcatCmdTcl_ContinueCmdTcl_ErrorCmdTcl_EvalCmdTcl_ExprCmdTcl_ForCmdTcl_ForeachCmdTcl_FormatCmdTcl_GlobalCmdTcl_IfCmdTcl_IncrCmdTcl_InfoCmdTcl_JoinCmdTcl_LappendCmdTcl_LindexCmdTcl_LinsertCmdTcl_ListCmdTcl_LlengthCmdTcl_LrangeCmdTcl_LreplaceCmdTcl_LsearchCmdTcl_LsortCmdTcl_ProcCmdTcl_RegexpCmdTcl_RegsubCmdTcl_RenameCmdTcl_ReturnCmdTcl_ScanCmdTcl_SetCmdTcl_SplitCmdTcl_StringCmdTcl_TraceCmdTcl_UnsetCmdTcl_UplevelCmdTcl_UpvarCmdTcl_WhileCmdTcl_CdCmdTcl_CloseCmdTcl_EofCmdTcl_ExecCmdTcl_ExitCmdTcl_FileCmdTcl_FlushCmdTcl_GetsCmdTcl_GlobCmdTcl_OpenCmdTcl_PutsCmdTcl_PwdCmdTcl_ReadCmdTcl_SeekCmdTcl_SourceCmdTcl_TellCmdTcl_TimeCmdTclSetupEnvTclDeleteVarsTcl_DetachPidsTcl_EvalTclExpandParseValueTclParseWordsTcl_CreateTraceTcl_DeleteTraceTcl_HashStatsTcl_UnsetVarTcl_UnsetVar2Tcl_UntraceVar2Tcl_VarTraceInfoTcl_VarTraceInfo2TclGetFramefflushabortstatopendirreaddirclosedirgetpwnamstrcatTcl_EvalFilewait3Tcl_ForkforkTcl_WaitPidswaitTcl_CreatePipelinemktempwritelseekunlinkpipedup2_exitexecvpTcl_ErrnoIdstrerrorTclMakeFileTableTclGetOpenFileTclParseQuotesTcl_ParseVarTclParseNestedCmdTclParseBracesTclWordEndstrcspnregexecTcl_ExprStringTcl_ExprBooleanatoiTclFindProcTcl_CommandCompleteTclIsProc_us_rsthread_stdiochdiraccesslstatreadlinkgeteuid_semgetc_filbuffdopengetwdfputcfreadfseekftellTcl_SignalMsgTcl_SignalIdsetenvputenvunsetenvprecTableoperatorStringsTcl_ExprLongTcl_ExprDoubleTcl_CreateCmdBufTcl_DeleteCmdBufTcl_AssembleCmd_XShmCompatBufCopy_XShmRealAlloc_XFlush_XSend_XReplybcopy_XShmFastBcopy_XReadPad_XRead_XError_XEatDatasys_errlistsys_nerr_XIOErrorFunction_XErrorFunction_qfree_XShmFlush_XWaitForWritable_XIOError_XEventsQueuedioctl_XEnq_XReadEvents_XWaitForReadable_XReadV_XShmSendData_XWriteV_XAllocID_XSetLastRequestRead_XUnknownWireEvent_XUnknownNativeEvent_XWireToEvent_XDefaultIOErrorXGetErrorTextXGetErrorDatabaseText_XAllocScratch_XVIDtoVisual_XFreeQ_XGetHostnamegethostname_XScreenOfWindowrecvmsgsendmsgXGetSizeHintsXGetWMHintscallocXGetZoomHintsXGetNormalHintsXGetIconSizesXGetCommandXGetTextPropertyXTextPropertyToStringListXGetTransientForHintXGetIconNameXpermallocrealloc_XrmInternalStringToQuarkXrmStringToQuarkXrmQuarkToString_Xdebug_XHeadOfDisplayListXSetAuthorizationXSetIOErrorHandler_XConnectDisplayXauGetAuthByAddr_XSendClientPrefixXauDisposeAuthfwriteffs_XDisconnectDisplay_XFreeDisplayStructureXSynchronize_XFreeExtDataXFreeModifiermap_XFreeKeyBindingsXConnectionNumberXDefaultScreenXDefaultRootWindowXDefaultVisualXDefaultGCXBlackPixelXWhitePixelXAllPlanesXQLengthXDisplayWidthXDisplayHeightXDisplayWidthMMXDisplayHeightMMXDisplayPlanesXDisplayCellsXScreenCountXServerVendorXProtocolVersionXProtocolRevisionXVendorReleaseXDisplayStringXDefaultDepthXDefaultColormapXBitmapUnitXBitmapBitOrderXBitmapPadXImageByteOrderXNextRequestXLastKnownRequestProcessedXScreenOfDisplayXDefaultScreenOfDisplayXDisplayOfScreenXRootWindowOfScreenXBlackPixelOfScreenXWhitePixelOfScreenXDefaultColormapOfScreenXDefaultDepthOfScreenXDefaultGCOfScreenXDefaultVisualOfScreenXWidthOfScreenXHeightOfScreenXWidthMMOfScreenXHeightMMOfScreenXPlanesOfScreenXCellsOfScreenXMinCmapsOfScreenXMaxCmapsOfScreenXDoesSaveUndersXDoesBackingStoreXEventMaskOfScreenXScreenNumberOfScreenXDestroyImageXGetPixelXPutPixelXSubImageXAddPixel_XProcessWindowAttributesXKeysymToKeycodeXLookupKeysymXGetKeyboardMappingXRebindKeysymXPending_XEventToWireXSetTextPropertyXSetWMIconNameXStoreNameXSetSizeHintsXSetZoomHintsXSetNormalHintsXSetIconSizesXSetStandardPropertiesXAllocStandardColormapXAllocWMHintsXAllocIconSizeXSetWMSizeHints_event_to_mask_XFlushGCCacheXSetModifierMappingXNewModifiermapXInsertModifiermapEntryXDeleteModifiermapEntryrindexXPutImageXQueryFont_XUpdateGCCache_XGenerateGCListXGContextFromGCXCreateImage_XGetScanlinePadXGetSubImage_XSetImage_libX_int__lock_libX_int__ulock_XShmInit_libX_int_usinit_libX_int_usgetinfo_libX_int_usopenpollsema_libX_int_usvsema_libX_int_uspsema_XShmEndBuf_XShmWaitForNotFullfcntlsocketconnectsleepinet_addrgethostbynamesetsockoptbzeroXrmInitializeXrmGetFileDatabaseXrmGetResourceXGetWMNameXGetWMIconNameXGetWMClientMachineXFreeStringListXauFileNameXauReadAuth_XSyncFunctionXSetAfterFunctionXGetPointerMapping_Reverse_Bytes_XInitImageFuncPtrs_XGetBitsPerPixel_libX_int__sproced_libX_int__nlock_libX_int__ilock_libX_int__flock_libX_int__wlock_libX_int__clock_libX_int__tlock_libX_int__ctlock_libX_int__dlock_libX_int__cas_libX_int__utrace_libX_int__us_mapsize_libX_int__us_maxusers_libX_int__us_locktype_libX_int__us_arenatype_libX_int__us_attachaddr_libX_int__utracefd_libX_int__ushaveinitted_libX_int__oserror_libX_int__uprint_libX_int__usgetpid_libX_int__usgettid_libX_int__usclean_tidmap_libX_int__setoserror_libX_int__usaddme_libX_int__syncinitftruncate_libX_int_mpin_libX_int_munpinmmap_libX_int_acreatemunmap_libX_int_amallopt_libX_int__ushardlock_create_libX_int__ushardlock_init_libX_int__ushardlock_attach_libX_int__ussoftlocks_init_libX_int__usretsfdfchmod_libX_int_getdtablesize_libX_int_usmalloc_libX_int_usnewsema_libX_int_vsprintf_libX_int__us_sthread_stdio_libX_int__us_sthread_misc_libX_int__us_rsthread_misc_libX_int__us_sthread_malloc_libX_int__us_rsthread_malloc_libX_int_usconfig_libX_int_usfreechmod_libX_int_usputinfo_libX_int_uscasinfo_libX_int__Psema_libX_int__usblock_libX_int__CPsema_libX_int__Vsema_libX_int__usunblock_libX_int_ustestsema_libX_int_usinitsema_libX_int_usfreesemaprctl_libX_int_uscpsema_libX_int__dssetlock_libX_int___dssetlock_libX_int___dswsetlock_libX_int__dsunsetlock_libX_int___dsunsetlock_libX_int__dhsetlock_libX_int___dhsetlock_libX_int__dhwsetlock_libX_int___dhwsetlock_libX_int__dhunsetlock_libX_int___dhunsetlockXrmStringToQuarkListXrmStringToBindingQuarkList_semputc_flsbufXrmQGetSearchListXrmQGetSearchResourceXrmQPutResourceXrmPutResourceXrmQPutStringResourceXrmPutStringResourceXrmPutLineResourceXrmGetStringDatabaseXrmPutFileDatabaseXrmMergeDatabasesXrmQGetResourceXrmDestroyDatabase_XrmGetResourceName_cassearchstart_cassearchend_lockcas1start_lockcas1end_clockcas1start_clockcas1end_lockcas2start_lockcas2end_unlockcas1start_unlockcas1end_unlockcas2start_unlockcas2end_scasfail_scasstart_scasend_hcasfail_hcasstart_hcasend_hcasmayhave_hcashavelock_libX_int_abortpagelockulimit_libX_int__lmalloc_libX_int__marena_libX_int__lfree_libX_int__lrealloc_libX_int__lmallopt_libX_int_amalloc_libX_int_afree_libX_int_arealloc_libX_int_acalloc_libX_int__sctllock_hcas_libX_int_bfclr_libX_int_bset_libX_int__ushardlock_detach_libX_int_bftstset_libX_int_bclrsginap_ssetlock_sunsetlock_scsetlock_scas__set_arg_valtan__libm_qnan_d_setoserrorz_abs___z_abs___hypot__hypot_err_val_sqrttable__set_err_val__infinity__gamma_err_val__set_res_valset_arg_valgamma_err_valhypot_err_valset_res_valset_err_val__libm_inf_d__libm_qnan_f__libm_inf_f__cur_chrtbl_open_read_close_setCchrclass__trap_fpe_override__call_exitfns_cleanup_bufendtab_sibuf_sobuf_smbuf_lastbuf_doprntatof_sbrk_brk_timezone_daylight_tzsetBSD_getime_cerror_sigtrampscanf_doscanfscanf_findiopfreopen_lseeksetpwentgetpwentrewindfgetpwentmemchrlocaltimeasctimememccpy_bufsync_sproced_xflsbuf_write_wrtchk_findbuf_isattystrcasecmpraisegetdents_mktempgetdtablesize_oserrorexeclpexecv_sys_nerr_sys_errlist_lock_ulock_nlock_ilock_flock_wlock_clock_tlock_ctlock_dlock_cas_bzeroinet_isaddrh_errno_gethostbyname_named_gethostbyaddr_named_gethtbyname_gethtbyaddr_setresordsubrstrtoksethostresorderres_initisdigit_inet_atohtenthostaliasgethostbyaddratexit_fp_class_d_dtoa_atod_end_minbrk_curbrk_tzname_altzonegmtime_isleapyear_legaltimeungetc_ioctl_getpid_kill_access_execv_blkclr_resdn_expanddn_skipname_getshortres_searchres_query_sethtent_endhtent_gethtentstrpbrkbcmpstrspnindexres_mkqueryres_sendres_querydomain_fp_class_f_tenscalemktime_ascftime_execvedn_comp_getlongputshortputlongp_queryinet_ntoaperrorwritevsendsendtorecv_res_close_dwmultu_cftime_fstat_res_opcodes_res_resultcodesfp_queryp_cdnamep_typep_classp_rrp_time@@ $@@" @b  @ @$6@  ") @ <$ Z 6@PVa-D  G[@1mq@ +1~@I$9< ##!@V '%G-D@nP U #' @%bJ Q@p o# &ie+i@ YC-w #nc@  ]3 #@P `u-9? 5A !7Bm ASASTVa L!9Au`C\7mK"'/AD:7*q [3 )VIA ya{I!,A4s.}g 7"-o[B!  =)#0KBQf$5Bep#%6{Bt",++&8Q]Bp  : '':7B@*G )(<BvOH) dT1)?#B`qc L#*D C@6 no+E1C~.q,F,CIN 5v-FCU 8y.G WC@S |/GbYCp?0GCP"Ɣ_-1HC. %_ B 2JiC? 5Q93LvCQ0!`G) ӆyX4MCW !5m5Ns(Cc"?H% +6OC`#6m C #7TCp#!'N +8U:Cp% '9Y?CD% $%:[DCp&&K{I/;\ID`' x%<^D(*p =`\D5@)K>3 { 8E>bksD^ *Mq+ 1(9?fD,7k: 8'@j_4D,s&OE_AlrDP-g) L |'BnD.Y%4.Y1CqD/p :\j #Dt?EP0)"#?2$tAEvEvE 1E<BVJ8EFwEN2R }G{lEN2YRH{sEZ 3'8 U I|SE^P3_V J|?ExP4]- !KvE4)b-LE5h@ !#ME6.m D'NaEא6h+tx kOEp7X<wm  !PMF7S* \ 3QAF5@8p}` RFDTP '_F0>`H Q 6`F`?WTV Oa`Fð?[vW: ^boRF@B3 cVFPB< d8F@CMT eOF֐C*^ f^FCB^ -grFِC]]d <hF C|#\ KiFܐC%b ZjF C!\ ikFߐC(\ xlFD 7\ mFpD)$\ nFDM \ oFPDi K\ pFD  +q .FE +_ rNFE# /o" sS FpE 5v t]!FPE 9, u~ FE =3d ,vFE A ;wGF Ev Jx1GF) Il Yy"G0FC MT hzGF` QQT w{GF~ U0 |&GF! Y^ };G F ]3d ~IG F a\ Y G F e\ fG G iO w&GG(' mh )G`GOM q E*  GG# {o8 GG ç G@HXa Ż64! G H 2UGH # d GpH# CzsG`I ƽG!pI+0 AJ9G"I[ Njh9G$@Iu nRG&I a~dG(I `~EG-I! ?-G/I  1G4I z!G6J [T :G7PJ($ ̯IgG? JL ΣZ+G@Jc X:GAJ} UhIGCJ ϽX!{GJpK sPy\GKK3 PkGLKO zGOKj ҙ43GSK GVPK iZG\K |; G^K u[&GbK1 ׃ Gc@L E  ףGkLe# (ٳB3#GlL9 , $VGwPL 6ܣ= GwL^ : ܷLGM= GMleGMP K t"GMg OGM! SE 2GM WT LG`M [ [1GM `x $GM d5 /G N i0G@N m1GN=) rk @EGNf zuGpN / GpO [P <!GOZ %]2GPM 7L'nN"GPi7 +p3G@P*  x-!G P */ GP: 0 G0Q  3 GȰQ<5 46GQq D6GQ  GQ' () 7/ GR 'H43nHS 1g HS 3%bYt/H:`T[ X  I:iH?PUG bm 'NHYpV9 HYpVB HYVP- D zORHX}$  F.hHX5 !==:HX5 " RH Y "Xc'HY+e "srHY "+ZHZ| 5(o?KH\ @-K %'H\0 Z0CH ] ` 0W) H ^  H ^"  H ^B$  HP^fH 0r=+H ^ 1SR H _1  Hp_N !2%\  eHՐa% 3h  HՐb.   HՐb/  ! Hb= 4r*ħH`bV 5z1=-Hpc? 2HpcL% 53jH܀cqF 5N4k!Hc 55Ō Hc  6Hc 57Ř,H@c" 68H`d "6;Hd< &6<H0dT -6.A Hdg 17-&B Hdz 57SC9Hd :8D D7Hd @8_1EG,HdC D 9% @FsnH`e Q:ESG He> U :a*bH*HeQ ^: fMHed b:uN H e+ f: O$H e lVH e& n]H e' pdHpf r: k+Hg." ; pHgP ; uHgn ; zHg ;Hg ;H0g ;,Hg ;:Hg <Hh <%J?H@h[ "Ik%YE ? $I k+_E @$(IPkeEA(,I`k iEB,-Il nEC0/Il:"sED41Il\&xE E83Il~E<F<7IlEGKFIl% FHOHII"0lFKbˑI"lFLq˘I#l GLM˞I$0m  I$0m GQN˵I$Pm2"GYO˷I$pmT GaP˹I$mt&GiQ˻I$mGqR˽I$mGu.SI%mGnUI'@mHHVI(`m HYW >I+nIYII+n I7zZO&I-n/Ib[u&I/`n>J:\̛I0PnMJM].̯I3po` 2  I3poj ?  I3pov K^L eI3o*K_PgI3o$K#`TiI3o$K+aXkI3p K3b\mI4@pKGck s6I7Pp* L dz!ͩI7p5/L e"ͱI7pd L#f%͸I7p"$L+g*ͺI8p$)L3h/ͼI8 p.L;"i4;I8p!2L]j56I;Ppu8Mtl6zIA qo*GNyq7vIA@qLNr<xIAPq(PNs=yIApqUNtB{IAq"ZNuG}IAr"_NvLIAr6 dNwQ΁IArV iNxV΃IBrv&nNy[΅IB0r"sNz`·IBPr"xN{eΉIBpr!}N|j΋IBskIBs N~lΎIBs3 NqΓIBsS"NvΘIBsu4N0{ΝICs? O.|ΥI[sTA}жGI]@s)U}P~I]t'U X% EIlt*YY}RIltYaTIltYeWImu 7 YlL]3I@uA^ӐIuU"^ӔIuw^ә I@u^ӥIu_ӪIu"_ӮIu_ӳ I@u_4 ӼIpu& _@Iv_HNIv*_ IvI_$Iv\ ( Ivi 5 Ivtg _(B"Iv-_ J-)IPwKb*w*IwPbX:sI`wTd4խIwAX d:ծIPx?cf,fGQIPyR${IPyv&}Iyff֘IP{gj[uI{*g3I|hLI|*"hI |L$h!I@|p h&I`|$h+I|h 0I|Vh7IP}'jI}:zjD+=I}k/)I@}-k >/Ip}k(B7hI~ *kQٟIÐ~7 nTbڡjI~LoDdf Ip $+q{Iΐ/G0qPiIvAw>I0Fw2DIJwJf`(INw݈I"Sw݊IXw݌I ]w ݎI%"awݫIG f  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdbcdbcdefghijklmnopqrstuvwxyz{|}~, ,ppp%@ - 1I:Hp KH܀ X@ ]H b@| n@ v@ TOoo;dO0ODOO@ 7D H JFc` H@ KFeP @ LFo@ M&F 2,@ @H` 8HD T@ NeF OpF ~H 7D @ PF 8D @  @l H0 @0 98D  @3  @% -H  5@P ?H  F@V SߠOZolo|-@-D-H-LbLO @nP  @pp  @r @  @p  @[ @  @  @  )@s\ 2@vT  ?@y0  L@zH XAp aAS nAu` {AD A A4 B BQ Bep Bt Bp B@ QF @" A  H 'H R/F <H CH` K@9 #`H gH 9lEP ~B B` 7D :E @  @!0 H @10 ;@& @4P !S!F T0F ;?EN E@Hl ; W@  i@^ |@ A`  @` B 9E  @P 9E BΜ  At UF` V%F W1F@ T?F XLFP ]@( YlF@ y@( @) ZF֐ @*\ [F @* !\Fِ @+ #]F  @, %^2Fܐ J@- '_aF  v@.  )`Fߐ @.t +aF @. -bFp @/ /cF  @/l 12@/ 3dGFP Z@/ 5mA z@1 =@1 ?@1 A.d@1 @2 @4  @ e F T &F(  3A A@d  TAK ( e@  t@l  C@  AR 4 @r4  @  ' H  @?p * @? , @@D . %@A 0f 3F g :F  HH  V OF sh UFp i cFP  nHp  uH  |@G 4 @G 6 @HT 9 @H = @I  @K  @L0  @M< @M @N  @N  @P0  1@Q$  @@ST  M@Y < ZEU  iH  nH  tH  zH 8 Dp = EZ  7 D4 7 D 8 E  B $ BЈ  BX  B  B4  B : 'E : 4E$ j CF  IC 7 XD  bAK * tB C  C   AP . @  @  @ k F l G m G n G0 o G p "G ! 0C " BC ! NC " aC 7 lDd " zC = E[  @P  @`  @ q G  @  @ rG  sG  #)C@ t?G  uLG  #WC< vmG wG xG yG yG wG $C zG yG =E[ A4 $C $*Cp {7G  |FG VH0 }]Gp ~sG` zG@ G"x G" yG AP 08D %C# &C: %C" 'CA (0CV ):Ca &HC. %[C" (lCQ0 :uE  G$@ %C( $C, G& G( %C! G- G/ %C)d %C%P G4 #G6 8/D AG7P NG< !YCP :nE!8 :|E  :EP HO*WO+[LO,^O-bLO.e$O-aO/gO0jDO Ah 61D /A 'ACI< 'PCL _Hh fG?  sG@ 'CO 7D GA 2YD$D(D,D0D42D5@ 3D^  3%D} $43D CB@ 4QD@ 5`D 2oDC 2DD 5D 4D 2D^  02D5 9Eh 4D 9E 3D^ 2DEl 2"DFL 1BĜ 3ED|8 "3ZDxx 2mDD 3~Dy 5DD 2D7 4DD 2D: 2DR (3Dz` 2D@ 2 DB 2!DB8 6xO?H FH eMFX e^F 7lD݄ 7|Dߘ GC GJp GK B GL GO GS GVP G\   C   C  -G^ 9Gb MJF (YGe iGk $C $C %CP %C" %C# %C% H  Hp 'C? )CW  ' CAH )Ca@ -Gl <Gq FGwP WH@ ^Gw hG pG zG G )C^ G 6Dt G` G G .C HP 6D Hլ 6D 6&DP 4H 68D 6HD\ 6UD8 eH 1jD2L 1tD)8 1D1p 1D2h 1D/x 6DL 6D G  6DD 6DT G@ 1D* H >"Et, 0H  7H@ @H II NI TI ZIP aI gI oI wI G 2DH 2DT *4D 3D (I 6D@ 6D 7Zp7D ?ExP 7!Dڬ 74D 7ED8 7UD$ @fE 7nD "?w$O:E/  #:E1 'AE AE AE AE AE| AE AE AE AE AE A"Et :0E=d )B>E BHE BTET B`E :lE0T %B{E BE˜ BE BEh BEd BE BEը BE֨ CEא DEp DE4 DE D#E8 D1E :=E, DHEl DUE( DcE< :pE. !C}Eh :E@ +DF EF EF EF d EF  EF  EF p EF EFD <EX EF"x EF' E)F' E4F*H E@F-t ELF/ !EZF/ #EfF0 %FrF5@ :~EC@ ->Eh 8D< ?E@ ?E 8D  8D 9E :E :E :E&  :E( :0E*H CBE NI UI  [I `I hI pI yI Ip >E^P I >Ea  I >Eb  I  >Ej  IP  I`  I I I I I I  GFEtt >&Ev8 ?5E{ ?DE ?QE} ?cE( ?rE }I" @E HF`< HF_t I# CEݸ IFb CE jI$0 I$P I$p  I$  I$  I$  I%  #I'@  *I(`  0I+ ! 6I+ " <I- # BI/` G HFA G VF@ F cF6 F jF8 F qF9X H zOH OH F^ H F^ I Fa I FaT I Fa  G  G M!Fs@ M! Fz M!F} $!I0P !!G M!0Fx M!:Fw M!AF *M!IF %!SO&!_j!hp!zp!p!GH !G8 M!FX ,M!Ft '!I3p M!Fp M!Fv0 !G M!Fh :!G M"F <M"F|x M"F} M"0F` M"CFx M"XF M"fFh $"wG "G M"F .M"FH 0M"F 4M"Fh 6("I3 M"F 8)"I3 *"I3 O"F O# F +#I3 O#F O#*F O#:F O#HF #TG #eG O#F P#F Q#F #H@ Q#F Q#F0 Q#F #p#pR$ FP $Gc $1G $BGŀ $SG $fG  ,$uI4@ -$|I7P $G R$F $G $G0 $GHH e$F@ V$Fð V$F V% F V%F V%,F8 V%7FX V%CFx V%OFĘ V%ZFĠ V%cFİ V%qF V%F V%F V%F0 V%FP V%Fx !V%Fň #V%FŘ %V%FŨ 'V%FŸ )V& F +V&F -V&(F /V&9F 1V&EF( 3V&UF8 5V&`FH 7V&pFX 9V&}Fh ;V&Fx =V&FƐ ?V&Fư AV&F CV&F EV&F GV'F IV''F KV'=F MV'PF  OV'gF0 QV'vF@ SV'FP UV'F` WV'Fp YV'Fǀ [V'Fǘ ]V'FǨ _V'FǸ aV'F cV(F eV(!F gV(7F0 iV(EFX kV(OFȀ mV(YFȨ oV(cF qW(mFP e(F e(F (Gx e(Fx g(F( (G w(G` w(G x(G y) G y)G y)&G y)6G y)DGX z)[Gh z)rG z)G )G!p )ŐO)GH )GE )GG )GH )GJ .*I7 *G %*"Gv *-GP *=Gz0 *NG *^H *kG *|GH *H  *p*p*G *H+H *H? *HP *HY/+HYp/+!G@ +-GP /+AI7 0+GI7 1+NI8 2+VI8  3+\I8 4+fI>@ 5+tIA  6+IA@ +Hx ;+HX 1+H 9+G° +G +G +G +H +H , G ,G ,,GȰ ,?G ,NH ",bG ,th,p,p,p,p,p,p,p,p-p-p-1i-Gi-^i-ui -i-h-h-H -H9@ !-H! . H! . H"X .:H .PH$ .cH  7.wIAP .H .H 8.IAp .HP 9.IA .H .H .H / H8 /'H /CH3 :/WIA /^H /vH /HM /H /i/i/i0i 0 i$0>H:` 0QH ;0bIA 0hH? 0|H?  0H?P 0HV 0HD` 0HGx 0HW 0HKX 1HK 1HN <1+IA 11HYx/1DH 1YHY/1oHY/1H 1HY/1H .1HY/1H (1HY/2 H 02$HY/2<HY 2QHZ 2mI% 2vI h 2~Hv 2Hx( 2H{0 !2H{ #2H|8 %2Hp +2H -3H0 /3H 33+H 53=HP 73MH =3`H( A3tH /3HH/3H$/3HH/3H/3H/3Hh/3Ht/3H/3HT/4Hp/4H|/4(H/42H/4=H/4FH</4PH/4[H0/4dH/4qH/4H =4IB >4IB0 4H 4ذO4H 4H 4Hh 4Hp 5H 5Hh 52H 5DHh 5XH 5^Hɨ 5nHP 5}H 5H 5Hx ?5IBP 5H  5H 5H 5H 5H` 5H 5i@6 IB  6HՐ 6HՐ 6&Hլ 6.H 6>#`6IHۤ A6Wk 6bH 6rHD  6H`  6H  6H  6HD  6Hۤ 6i6i6i6jB6IB C6IB D7IB 7Hݨ 7j E7*IC@ 79I 7BO7Mo7T@o7[o7bj0F7kIF G7sI[ H7xI]@ H7~I]x I7kI7kI7Iap J7Il K7Il L7Il 7H M7Im 7H( N7I@ 7H O7I 7H 7H P7I 8H Q8 I@ I8I] 8I R8$I 8,I8 85j8>I  S8GI 8NI  8VI  T8_I 8gI0 U8rI@ V8xIp W8I X8I @8IBp 8I Y8I Z8k[8O8p8p8p8p8p8p8p8p8q9q9 q\9I 39I8 ]9"q ]9*I( ]9?I ]9TI ]9aI 49nI;P ^9}IP 49I= _9I `9I` ]9I a9IH 49I@ E9IB b9IP e9I f9IP H9`oH9`OH9dOI:kI:kI:I_  g:Ih I:$Ig h:/I i:6I j:=I  k:EI@ l:KI` m:SI \:ZI _:b On:gI n:qI n:}I a:I a:I ]:I( ]:I ]:I o:IP p:I q:I r:I@ s:Ip t:I a:I( b:I( u;IÐ g;I v;I w; Ip n;(Ih n;0I n;9I n;BI( x;JIΐ y;RI z;\I0 {;cI |;jI };oI ~;vI t;{IX ;I v;I ;I x;Ox;Ox;Iθ x;IҘ x;I x;I x;I( x;I@